High-Performance Computing at the NIH

SAPS - Statistical Analysis of Protein Sequences
Help

Acceptable sequence formats: GCG, EMBL, Fasta, Swissprot, Genbank, ASN1

Upload sequence file:

Or
Paste sequence into this box:

Output: Species:

Positive residues:


Sample Data: (Cut&Paste ALL the green text)
>chiins insulin2.msf, 107 aa.
BALWIRSLPLLALLVFSGPGTSYAAANQHLCGSHLVEALYLVCGERGFFYSPKARRDVEQ
PLVSSPLRGEAGVLPFQQEEYEKVKRGIVEQCCHNTCSLYQLENYCN