National Heart, Lung, and Blood Institute

Epithelial Systems Biology Laboratory (ESBL)


Mouse mpkCCD Phosphoprotein Database

The mpkCCD Cell Phosphoproteomic Database (mCPD) contains protein mass spectrometry data from the NHLBI Epithelial Systems Biology Laboratory (Knepper Lab). All data are obtained from a clonal mpkCCD cell line "clone 11" (Yu et al.PMID: 19190182), derived from mouse cortical collecting duct (Bens et al.,1999, PMID: 10232677). Please cite: Rinschen MM, Yu MJ, Wang G, Boja ES, Hoffert JD, Pisitkun T, Knepper MA. Quantitative phosphoproteomic analysis reveals vasopressin V2-receptor-dependent signaling pathways in renal collecting duct cells. Proc Natl Acad Sci U S A. 2010; 107: 3882-7. PMID: 20139300.

Experiment description:
The cells were grown on membrane supports until confluence and treated with the vasopessin V2 receptor specific agonist dDAVP for 3 days (1nM). After withdrawal of the hormone for 6h, cells were treated with dDAVP 0.1nM or vehicle for 30 min. All experiments were conducted using Stable Isotope Labeling by Amino-Acids in Cell culture (SILAC), which enables quantification of the hormone effect for a large number of peptides. The ratio log2(dDAVP/vehicle) is given for the corresponding peptide. In the "Sig." column, * indicates that dDAVP/vehicle ratios were successfully measured in all three replicates and the difference was significantly changed ratio in peptide phosphorylation in student's two-tailed t-test (p<0.05). For more details, see Rinschen et al. Proc Natl Acad Sci U S A. 2010; 107: 3882-7. PMID: 20139300.

The mCPD was created by Markus M. Rinschen, Ming-Jiun Yu, Guozhong Ma, Trairak Pisitkun, and Mark A. Knepper. Contact us with questions or comments. Download Data Here.


Use Browser's Find Command (Ctrl-F) to Search

RefSeq number Gene symbol Peptide sequence Protein name Phospho-site(s)   log2 (dDAVP/vehicle)  
            Exp. 1 Exp. 2 Exp. 3 Sig.
NP_001035195 Aak1 ILS*DVTHSAVFGVPASK AP2 associated kinase 1 isoform 1 S635   7.85      
NP_001035195 Aak1 VGSLT*PPS*SPK AP2 associated kinase 1 isoform 1 T618, S621     -0.36 -0.32  
NP_001035195 Aak1 VGSLT*PPS*SPKTQR AP2 associated kinase 1 isoform 1 T618, S621       -0.32  
NP_001035195 Aak1 VGSLT*PPSS*PK AP2 associated kinase 1 isoform 1 T618, S622   -0.58 -0.38 -0.32 *
NP_001035195 Aak1 VQTT*PPPTIQGQK AP2 associated kinase 1 isoform 1 T604   -0.14      
NP_666329 Aars LSRAANT*QKCIRAGGK alanyl-tRNA synthetase T72          
NP_031405 Abca2 IRQNS*SFTEKT*NEIR ATP-binding cassette, sub-family A (ABC1), member 2 S628, T634          
NP_062425 Abcb10 RGPAVRAWAPAVS*SR ATP-binding cassette, sub-family B, member 10 S27          
NP_083296 Abcb8 IVALVGQS*GGGK ATP-binding cassette, sub-family B (MDR/TAP), member 8 S491          
NP_032602 Abcc1 GSS*QLDVNEEVEALIVK ATP-binding cassette, sub-family C, member 1 S290   -1.06      
NP_766500 Abcc12 LMNRFS*K ATP-binding cassette, sub-family C (CFTR/MRP), member 12 S910          
NP_001028508 Abcc4 ENEEAEPSTAPGT*PTLR ATP-binding cassette, sub-family C (CFTR/MRP), member 4 T646     -0.69    
NP_001028508 Abcc4 KENEEAEPSTAPGT*PTLR ATP-binding cassette, sub-family C (CFTR/MRP), member 4 T646   -0.08      
NP_038882 Abcf1 GGNVFEALIQDDS*EEEEEEEENR ATP-binding cassette, sub-family F (GCN20), member 1 S138   0.31      
NP_038882 Abcf1 QLSVPAS*DEEDEVPAPIPR ATP-binding cassette, sub-family F (GCN20), member 1 S107     -0.03    
NP_038882 Abcf1 SKPAAADS*EGEEEEEDTAK ATP-binding cassette, sub-family F (GCN20), member 1 S194   0.32 -0.02 -0.01  
NP_038882 Abcf1 SKPAAADS*EGEEEEEDTAKEKEPPQQGK ATP-binding cassette, sub-family F (GCN20), member 1 S194       -0.16  
NP_001106174 Abl1 RPS*LPALHFIK c-abl oncogene 1, receptor tyrosine kinase isoform a S16          
NP_001129576 Abl2 STQASSGS*PALPR arg tyrosine kinase isoform a S621       -1.49  
NP_001096647 Ablim1 TLS*PTPSAEGYQDVR actin-binding LIM protein 1 isoform 2 S355   -0.39 -0.06 -0.03  
NP_001096647 Ablim1 TLS*PTPS*AEGYQDVR actin-binding LIM protein 1 isoform 2 S355, S359   1.58      
NP_001096647 Ablim1 STS*QGSINSPVYSR actin-binding LIM protein 1 isoform 2 S376   0.58 0.61 0.05  
NP_001096647 Ablim1 GVS*MPNMLEPK actin-binding LIM protein 1 isoform 2 S629     0.37    
NP_001096647 Ablim1 TS*SESIYSR actin-binding LIM protein 1 isoform 2 S276   -0.58      
NP_001096647 Ablim1 TS*SESIYSRPGSSIPGSPGHTIYAK actin-binding LIM protein 1 isoform 2 S276     -0.02 0.04  
NP_001096647 Ablim1 TSS*ESIYSRPGSSIPGSPGHTIYAK actin-binding LIM protein 1 isoform 2 S277   0.54   -0.29  
NP_001096647 Ablim1 T*SSESIYSRPGSSIPGSPGHTIYAK actin-binding LIM protein 1 isoform 2 T275       -0.29  
NP_001096647 Ablim1 S*SGREEDEEELLR actin-binding LIM protein 1 isoform 2 S510          
NP_001096647 Ablim1 TSS*LPGYGK actin-binding LIM protein 1 isoform 2 S578     0.33 -0.41  
NP_803229 Abpz ET*VAYEKIQDCYK androgen binding protein zeta T56          
NP_084414 Acap2 SSPS*TGS*LDSGNESK centaurin, beta 2 S381, S384       0.19  
NP_084414 Acap2 SSPSTGS*LDSGNESK centaurin, beta 2 S384       -0.11  
NP_084414 Acap2 SSPST*GSLDSGNESK centaurin, beta 2 T382       0.12  
NP_084414 Acap2 SSPST*GS*LDSGNESK centaurin, beta 2 T382, S384       0.19  
NP_694791 Acat3 LKPY*FLTDGTGT*VTTANATGMNDGAAAVVLMKKTEAER acetyl-Coenzyme A acetyltransferase 3 Y237, T245          
NP_001078941 Acin1 SLIPDIKPLAGQEAVVDLHADDSRIS*EDETER apoptotic chromatin condensation inducer 1 isoform 3 S141   0.71      
NP_001078941 Acin1 TAQVPS*PPR apoptotic chromatin condensation inducer 1 isoform 3 S246   -0.02 0.14 0.08  
NP_001078941 Acin1 GVQAGNS*DTEGGQPGR apoptotic chromatin condensation inducer 1 isoform 3 S81   0.40 0.01 -0.22  
NP_001078941 Acin1 GVQAGNSDT*EGGQPGR apoptotic chromatin condensation inducer 1 isoform 3 T83   0.22 0.04 -0.19  
NP_001078942 Acin1 APVVLQPEQIVSEEET*PPPLLTK apoptotic chromatin condensation inducer 1 isoform 4 T417   -0.06      
NP_001078942 Acin1 LQPEQGS*PK apoptotic chromatin condensation inducer 1 isoform 4 S729   -0.02      
NP_001078942 Acin1 S*QSPS*PPPLPEDLEK apoptotic chromatin condensation inducer 1 isoform 4 S387, S391     0.30 -0.08  
NP_001078942 Acin1 SLS*PLSGTTDTK apoptotic chromatin condensation inducer 1 isoform 4 S479   0.22 -0.20 -0.02  
NP_001078942 Acin1 SQS*PS*PPPLPEDLEK apoptotic chromatin condensation inducer 1 isoform 4 S389, S391     0.13 -0.10  
NP_001078942 Acin1 SQS*PSPPPLPEDLEK apoptotic chromatin condensation inducer 1 isoform 4 S389   0.15      
NP_001078942 Acin1 SQSPS*PPPLPEDLEK apoptotic chromatin condensation inducer 1 isoform 4 S391     0.18    
NP_001078942 Acin1 SSSFSEEKGES*DDEKPR apoptotic chromatin condensation inducer 1 isoform 4 S216   0.50   -0.18  
NP_598798 Acly TAS*FSESRADEVAPAKK ATP citrate lyase S455       -0.10  
NP_598798 Acly T*ASFSESRADEVAPAKK ATP citrate lyase T453       0.40  
NP_666309 Acsm2 TVT*GKIER acyl-CoA synthetase medium-chain family member 2A T556          
NP_031419 Actb QEYDES*GPSIVHR actin, beta S365          
NP_780706 Actbl2 AVFPS*MVGR actin, beta-like 2 S34          
NP_780706 Actbl2 AVFPS*MVGRPR actin, beta-like 2 S34          
NP_598917 Actn1 CQKICDQWDNLGALT*QKR actinin, alpha 1 T490          
NP_001004365 Actr3b AEPEDHYFLMT*EPPLNTPENR ARP3 actin-related protein 3 homolog B T113          
NP_766207 Adamts10 T*NPFVWSSCSR a disintegrin-like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 10 T428     -0.10    
NP_742050 Adamts16 YISGKY*R a disintegrin-like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 16 Y1085   -2.77      
NP_536683 Adcy4 ALRAT*FREALSSLHSR adenylate cyclase 4 T202       >10  
NP_001019629 Add1 QKGS*EENLDETR adducin 1 (alpha) isoform 1 S586       0.46  
NP_001019629 Add1 TPS*FLK adducin 1 (alpha) isoform 1 S724       -0.47  
NP_001019629 Add1 TPS*FLKK adducin 1 (alpha) isoform 1 S724   0.51 0.19 -0.42  
NP_038786 Add3 TEEVLSPDGSPS*KSPSK adducin 3 (gamma) S679       -0.66  
NP_038786 Add3 TEEVLSPDGSPS*KSPSKK adducin 3 (gamma) S679     -0.69 -0.61  
NP_038786 Add3 TEEVLSPDGSPSKS*PSK adducin 3 (gamma) S681     -0.56 -0.62  
NP_038786 Add3 TEEVLSPDGSPSKS*PSKK adducin 3 (gamma) S681       -0.65  
NP_038786 Add3 TEEVLSPDGSPSKSPS*K adducin 3 (gamma) S683       -0.66  
NP_891558 Adm2 RDS*APVDPSSPHSYG adrenomedullin 2 S138     0.33    
NP_031444 Adra2c VAKLRT*RTLSEKR adrenergic receptor, alpha 2c T241       15.66  
NP_081649 Afap1 SGTSS*PQSPVFR actin filament associated protein 1 S666       -0.06  
NP_081649 Afap1 SGTSSPQS*PVFR actin filament associated protein 1 S669       0.28  
NP_666214 Afap1l2 KFS*EPNTYIDGLPSR actin filament associated protein 1-like 2 S428   7.44      
NP_666214 Afap1l2 KKS*TSLEPPER actin filament associated protein 1-like 2 S288       0.39  
NP_666214 Afap1l2 VAQQPLSLVGCDVLPDPSPDHLY*SFR actin filament associated protein 1-like 2 Y357   -0.42      
NP_666214 Afap1l2 VAQQPLSLVGCDVLPDPSPDHLYS*FR actin filament associated protein 1-like 2 S358   0.67      
NP_291043 Aff4 SS*SPGKPQAVSSLSSSHSR AF4/FMR2 family, member 4 S174       -0.08  
NP_291043 Aff4 SSS*PGKPQAVSSLSSSHSR AF4/FMR2 family, member 4 S175       -0.17  
NP_852076 Aftph SFS*PGDFR aftiphilin protein S151     -0.21    
NP_631892 Agap3 ATPTTAPGTS*PR centaurin, gamma 3 S478       -3.30  
NP_848870 Agbl2 EKGTSLDPPLTS*PKNK ATP/GTP binding protein-like 2 S797          
NP_034602 Agfg1 GTPSQS*PVVGR ArfGAP with FG repeats 1 S181   -3.99 -1.52 -1.45  
NP_034602 Agfg1 GT*PSQS*PVVGR ArfGAP with FG repeats 1 T177, S181   -3.96      
NP_034602 Agfg1 SLLGESAPALHLNKGT*PSQS*PVVGR ArfGAP with FG repeats 1 T177, S181       2.18  
NP_080651 Ahctf1 SVTRNSILDQY*GK AT hook containing transcription factor 1 Y1000       >10  
NP_033773 Ahnak AES*PEMEVNLPK AHNAK nucleoprotein isoform 1 S893     -0.42    
NP_033773 Ahnak ASLGS*LEGEVEAEASSPK AHNAK nucleoprotein isoform 1 S5525   1.76      
NP_033773 Ahnak ASLGSLEGEVEAEASS*PK AHNAK nucleoprotein isoform 1 S5536   -1.22      
NP_033773 Ahnak EFS*APST*PTGTLEFAGGDAK AHNAK nucleoprotein isoform 1 S5563, T5567   -2.32      
NP_033773 Ahnak EFSAPST*PTGTLEFAGGDAK AHNAK nucleoprotein isoform 1 T5567   -1.79      
NP_033773 Ahnak FKAEAPLPS*PK AHNAK nucleoprotein isoform 1 S4890   -3.32   -1.00  
NP_033773 Ahnak GDLGASS*PSMK AHNAK nucleoprotein isoform 1 S5099       -1.90  
NP_033773 Ahnak GGVTGS*PEASISGSK AHNAK nucleoprotein isoform 1 S5504   -0.77 -0.93 -0.49 *
NP_033773 Ahnak GGVTGSPEAS*ISGSK AHNAK nucleoprotein isoform 1 S5508       -0.43  
NP_033773 Ahnak GGVTGSPEASIS*GSKGDLK AHNAK nucleoprotein isoform 1 S5510       -0.08  
NP_033773 Ahnak GHYEVT*GSDDEAGK AHNAK nucleoprotein isoform 1 T5605       -0.22  
NP_033773 Ahnak GHYEVTGS*DDEAGK AHNAK nucleoprotein isoform 1 S5607   -0.51   -0.24  
NP_033773 Ahnak GHYEVTGS*DDEAGKLQGSGVSLASK AHNAK nucleoprotein isoform 1 S5607       -0.26  
NP_033773 Ahnak GKGGVTGS*PEASISGSK AHNAK nucleoprotein isoform 1 S5504       -0.60  
NP_033773 Ahnak LPS*GSGPAS*PTTGSAVDIR AHNAK nucleoprotein isoform 1 S211, S217   -1.37 -0.27 -0.39  
NP_033773 Ahnak LPS*GSGPASPT*TGSAVDIR AHNAK nucleoprotein isoform 1 S211, T219     -0.42 -0.36  
NP_033773 Ahnak LPS*GSGPASPTT*GSAVDIR AHNAK nucleoprotein isoform 1 S211, T220     -0.34    
NP_033773 Ahnak LPS*GSGPASPTTGSAVDIR AHNAK nucleoprotein isoform 1 S211   -0.33 -0.80 -0.79  
NP_033773 Ahnak LPSGS*GPAS*PTTGSAVDIR AHNAK nucleoprotein isoform 1 S213, S217   -0.69 -0.27 -0.39  
NP_033773 Ahnak LPSGS*GPASPTT*GSAVDIR AHNAK nucleoprotein isoform 1 S213, T220     -0.14 -0.29  
NP_033773 Ahnak LPSGS*GPASPTTGSAVDIR AHNAK nucleoprotein isoform 1 S213     -0.80    
NP_033773 Ahnak LPSGSGPAS*PTTGSAVDIR AHNAK nucleoprotein isoform 1 S217   -0.80 -0.23 -0.33  
NP_033773 Ahnak LPSGSGPASPT*TGSAVDIR AHNAK nucleoprotein isoform 1 T219       -0.33  
NP_033773 Ahnak LPSGSGPASPTT*GSAVDIR AHNAK nucleoprotein isoform 1 T220   -0.87      
NP_033773 Ahnak LRS*EDGVEGDLGETQSR AHNAK nucleoprotein isoform 1 S136   -1.02   -0.12  
NP_033773 Ahnak SGSGPAS*PTTGSAVDIR AHNAK nucleoprotein isoform 1 S217   0.24      
NP_033773 Ahnak SKGHYEVTGS*DDEAGK AHNAK nucleoprotein isoform 1 S5607       -0.43  
NP_033773 Ahnak SNS*FSDER AHNAK nucleoprotein isoform 1 S5555   0.50      
NP_033773 Ahnak SSEVVLS*GDDEDYQR AHNAK nucleoprotein isoform 1 S116       -0.11  
NP_033773 Ahnak VKT*PEMIIQKPK AHNAK nucleoprotein isoform 1 T496       -0.96  
NP_001035048 Ahnak KGDRS*PEPGQTWTHEVFSSR AHNAK nucleoprotein isoform 3 S94   0.12   -0.32  
NP_001035048 Ahnak KGDRSPEPGQT*WTHEVFSSR AHNAK nucleoprotein isoform 3 T100          
NP_001035048 Ahnak KGDRSPEPGQTWT*HEVFSSR AHNAK nucleoprotein isoform 3 T102          
NP_001035048 Ahnak S*PEPGQTWTHEVF AHNAK nucleoprotein isoform 3 S94          
NP_001035048 Ahnak S*PEPGQTWTHEVFSSR AHNAK nucleoprotein isoform 3 S94   0.02      
NP_033774 Ahrr T*PS*GT*ALPPR aryl-hydrocarbon receptor repressor T251, S253, T255          
NP_663464 AI661453 ALEPEQPREPRPETPGS*PR hypothetical protein LOC224833 S368       0.16  
NP_663464 AI661453 EPRPETPGS*PR hypothetical protein LOC224833 S368   -0.39      
NP_663464 AI661453 RLS*LEGAR hypothetical protein LOC224833 S1131   0.18 0.88 0.70  
NP_663464 AI661453 SFSSPPS*PSYK hypothetical protein LOC224833 S984   -0.60      
NP_663464 AI661453 SPSSS*SLPER hypothetical protein LOC224833 S529     -0.51    
NP_001028371 AI747448 VRADGGT*NSARR calcium activated chloride channel T686          
NP_598910 AI837181 ARS*WVGAER basophilic leukemia expressed protein BLES03 S36       1.63  
NP_766233 AI848100 RTS*FPLIR membrane protein CH1 S1073       3.66  
NP_660126 Aif1l ANES*SPKPAGPPPER allograft inflammatory factor 1-like S133       -0.51  
NP_660126 Aif1l ANESS*PKPAGPPPER allograft inflammatory factor 1-like S134   -0.84 -0.90 -0.53 *
NP_001156442 Aim1l NVT*RTVRAVVVS*PRAEGSPSR absent in melanoma 1-like T215, S224          
NP_031952 Aimp1 QQS*AAASTDSKPIDASR small inducible cytokine subfamily E, member 1 S147          
NP_001036006 Akap1 RRS*ESSGNLPSVADTR A-kinase anchor protein 1 S101       2.04  
NP_112462 Akap12 AEADASGNLTKES*PDTNGPK A kinase (PRKA) anchor protein (gravin) 12 S1645       -0.74  
NP_112462 Akap12 AEADASGNLTKESPDT*NGPK A kinase (PRKA) anchor protein (gravin) 12 T1648       -0.66  
NP_112462 Akap12 CQETESNEEQSIS*PEKR A kinase (PRKA) anchor protein (gravin) 12 S1292   -0.64      
NP_112462 Akap12 EKEPTKPLES*PTSPVSNETTSSFK A kinase (PRKA) anchor protein (gravin) 12 S270       -0.88  
NP_112462 Akap12 EKEPTKPLESPT*SPVSNETTSSFK A kinase (PRKA) anchor protein (gravin) 12 T272       -0.90  
NP_112462 Akap12 EKEPTKPLESPTS*PVSNETTSSFK A kinase (PRKA) anchor protein (gravin) 12 S273       -1.16  
NP_112462 Akap12 ESELKQS*TEKQEGTLK A kinase (PRKA) anchor protein (gravin) 12 S221       0.24  
NP_112462 Akap12 GPSEAPQEAEAEEGAT*SDGEK A kinase (PRKA) anchor protein (gravin) 12 T583       -0.28  
NP_112462 Akap12 GPSEAPQEAEAEEGAT*SDGEKKR A kinase (PRKA) anchor protein (gravin) 12 T583       -0.50  
NP_112462 Akap12 GPSEAPQEAEAEEGATS*DGEK A kinase (PRKA) anchor protein (gravin) 12 S584   0.18 -0.05 -0.24  
NP_112462 Akap12 GPSEAPQEAEAEEGATS*DGEKK A kinase (PRKA) anchor protein (gravin) 12 S584       0.07  
NP_112462 Akap12 GPSEAPQEAEAEEGATS*DGEKKR A kinase (PRKA) anchor protein (gravin) 12 S584       -0.51  
NP_112462 Akap12 HPEGIVSEVEMLSS*QER A kinase (PRKA) anchor protein (gravin) 12 S489   -1.03      
NP_112462 Akap12 KLFS*SSGLK A kinase (PRKA) anchor protein (gravin) 12 S505       -0.82  
NP_112462 Akap12 KLFSS*SGLK A kinase (PRKA) anchor protein (gravin) 12 S506       -0.83  
NP_112462 Akap12 RPS*ESDKEEELDK A kinase (PRKA) anchor protein (gravin) 12 S613       -0.39  
NP_112462 Akap12 RPS*ESDKEEELDKVK A kinase (PRKA) anchor protein (gravin) 12 S613       -0.29  
NP_112462 Akap12 S*ATLSS*TESTASGMQDEVR A kinase (PRKA) anchor protein (gravin) 12 S626, S631       0.17  
NP_112462 Akap12 SATLS*S*TESTAS*GMQDEVR A kinase (PRKA) anchor protein (gravin) 12 S630, S631, S637       -0.24  
NP_112462 Akap12 SATLS*S*TESTASGMQDEVR A kinase (PRKA) anchor protein (gravin) 12 S630, S631       0.11  
NP_112462 Akap12 SATLS*ST*ESTASGMQDEVR A kinase (PRKA) anchor protein (gravin) 12 S630, T632       0.11  
NP_112462 Akap12 SATLSS*TEST*ASGMQDEVR A kinase (PRKA) anchor protein (gravin) 12 S631, T635       -0.15  
NP_112462 Akap12 SATLSS*TESTAS*GMQDEVR A kinase (PRKA) anchor protein (gravin) 12 S631, S637       -0.18  
NP_112462 Akap12 SATLSST*ESTAS*GMQDEVR A kinase (PRKA) anchor protein (gravin) 12 T632, S637       -0.18  
NP_112462 Akap12 SPEQPAESDTPSELELS*GHGPAAEASGAAGDPADADPATK A kinase (PRKA) anchor protein (gravin) 12 S27       -1.41  
NP_112462 Akap12 VDEEEGEKTEPAPAEEQEPAEGT*DQARLSADYEK A kinase (PRKA) anchor protein (gravin) 12 T344       -0.66  
NP_112462 Akap12 VDEEEGEKTEPAPAEEQEPAEGTDQARLS*ADYEK A kinase (PRKA) anchor protein (gravin) 12 S350   0.46   -1.15  
NP_083608 Akap13 FLSHS*TDSLNK A kinase (PRKA) anchor protein 13 S1892   -0.06      
NP_001036007 Akap4 MDMSNMVLS*LIQK A-kinase anchor protein 4 isoform b S624       <-10  
NP_062748 Akap8 ADS*DGDLS*ENDDGAGDLR A kinase anchor protein 8 S320, S325       -0.01  
NP_062748 Akap8 S*GDEEFRGEDDLCDSR A kinase anchor protein 8 S336          
NP_001007590 Akirin2 TLDFDPLLSPAS*PK akirin 2 S21   -0.14      
NP_001007590 Akirin2 FT*HDQIMR akirin 2 T184     2.88    
NP_080546 Akt1s1 LNT*SDFQK AKT1 substrate 1 (proline-rich) T247   -6.19 0.24 0.30  
NP_080546 Akt1s1 S*LPVSVPVWAFK AKT1 substrate 1 (proline-rich) S184   0.61   -0.12  
NP_062672 Aldh18a1 IHARGPVGLEGLLTT*K pyrroline-5-carboxylate synthetase isoform 1 T760       >10  
NP_033787 Aldoc GILAADESVGS*MAK aldolase C, fructose-bisphosphate S39          
NP_081220 Alkbh3 SQSATQPAS*PAR AlkB homolog 3 S28   -1.91      
NP_766531 Alkbh5 RGS*FSSENYWR alkB, alkylation repair homolog 5 S362   0.96 0.46 0.65 *
NP_766531 Alkbh5 RGSFS*SENYWR alkB, alkylation repair homolog 5 S364       0.63  
NP_766531 Alkbh5 KSYESSEDCPEAASS*PTR alkB, alkylation repair homolog 5 S385   0.57   0.10  
NP_766531 Alkbh5 SYESSEDCPEAASS*PTR alkB, alkylation repair homolog 5 S385   0.37      
NP_766531 Alkbh5 SYESSEDCPEAASS*PTRK alkB, alkylation repair homolog 5 S385   0.47      
NP_766531 Alkbh5 Y*QEDSDPERSDYEEHQLQK alkB, alkylation repair homolog 5 Y61          
NP_766531 Alkbh5 YQEDS*DPERSDYEEHQLQK alkB, alkylation repair homolog 5 S65   -0.01   -0.12  
NP_660258 Alms1 ES*FVEEVPHIEYVQK Alstrom syndrome 1 S1480          
NP_660258 Alms1 MVS*KGVQAGNLEIVAGVKK Alstrom syndrome 1 S2977          
NP_001032371 Alpk2 AETNNST*GHIY*GGSEPRTR alpha-kinase 2 T1536, Y1540          
NP_695231 Amot TGS*RDCST*QT*ER angiomotin S605, T610, T612          
NP_001074864 Amotl1 ELQSISEAYES*LVKS*T*T*KR angiomotin-like 1 S496, S500, T501, T502          
NP_062738 Amotl2 S*RKDPGKATQGTLRPAK angiomotin like 2 S647          
NP_062738 Amotl2 SRKDPGKAT*QGTLRPAK angiomotin like 2 T655          
NP_033797 Ampd3 S*QSLSLQMPTQQDWK adenosine monophosphate deaminase 3 S83       -0.42  
NP_033797 Ampd3 SQS*LSLQMPTQQDWK adenosine monophosphate deaminase 3 S85       -0.48  
NP_001036176 Amy2b NCRLT*GLLDLALEKDYVR amylase 2b, pancreatic T175          
NP_038941 Angptl3 Y*NKPRTKSRPER angiopoietin-like 3 Y417          
NP_112148 Ankrd17 EHYPVS*SPSSPS*PPAQPGGVSR ankyrin repeat domain protein 17 isoform a S2037, S2043       -0.19  
NP_112148 Ankrd17 EHYPVSSPS*SPS*PPAQPGGVSR ankyrin repeat domain protein 17 isoform a S2040, S2043       0.01  
NP_112148 Ankrd17 EHY*PVSSPSSPS*PPAQPGGVSR ankyrin repeat domain protein 17 isoform a Y2034, S2043       -0.04  
NP_082666 Anln AAS*PSKPPISNASATPVGR anillin S180   -0.86      
NP_082666 Anln SCTKPSPSKKRCS*DK anillin S73          
NP_082666 Anln TASPLKT*EARKPCEKPT*LS*QGAQPK anillin T322, T332, S334       >10  
NP_034860 Anxa1 CAT*STPAFFAEK annexin A1 T272          
NP_001103681 Anxa6 VMVS*RSEIDLLNIR annexin A6 isoform b S622       0.55  
NP_001108481 Ap1gbp1 SLS*LGDKEISR synergin, gamma isoform 1 S1067          
NP_031486 Ap3d1 HSSLPT*ESDEDIAPAQR adaptor-related protein complex 3, delta 1 subunit T758       -0.46  
NP_031486 Ap3d1 HSSLPTES*DEDIAPAQR adaptor-related protein complex 3, delta 1 subunit S760   -0.55   -0.46  
NP_031486 Ap3d1 VDIITEEMPENALPS*DEDDKDPNDPYR adaptor-related protein complex 3, delta 1 subunit S784   1.56      
NP_573500 Apcdd1 S*HPRSLEKSAWR adenomatosis polyposis coli down-regulated 1 S34          
NP_033817 Apex1 AAADDGEEPKS*EPETK APEX nuclease 1 S18       0.00  
NP_033817 Apex1 AAADDGEEPKS*EPETKK APEX nuclease 1 S18       -0.32  
NP_033817 Apex1 AAADDGEEPKSEPET*KK APEX nuclease 1 T22       3.40  
NP_033817 Apex1 KAAADDGEEPKS*EPETK APEX nuclease 1 S18       -0.22  
NP_084219 Apex2 GPPSDPS*S*R apurinic/apyrimidinic endonuclease 2 S504, S505          
NP_031492 Api5 TSEDTSSGS*PPK apoptosis inhibitor 5 S464   1.19      
NP_031492 Api5 TSEDTSSGS*PPKKSPGGPK apoptosis inhibitor 5 S464       0.19  
NP_033829 Aqp2 QS*VELHSPQSLPR aquaporin 2 S256          
NP_033829 Aqp2 RQS*VELHSPQSLPR aquaporin 2 S256   1.84   0.11  
NP_033829 Aqp2 RRQS*VELHSPQSLPR aquaporin 2 S256       0.99  
NP_033829 Aqp2 QS*VELHS*PQSLPR aquaporin 2 S256, S261          
NP_033829 Aqp2 RQS*VELHS*PQSLPR aquaporin 2 S256, S261     -5.10 -3.99  
NP_033829 Aqp2 RRQS*VELHS*PQSLPR aquaporin 2 S256, S261       -4.08  
NP_033829 Aqp2 QS*VELHS*PQS*LPR aquaporin 2 S256, S261, S264          
NP_033829 Aqp2 QS*VELHSPQS*LPR aquaporin 2 S256, S264          
NP_033829 Aqp2 RQS*VELHSPQS*LPR aquaporin 2 S256, S264       0.51  
NP_033829 Aqp2 RRQS*VELHSPQS*LPR aquaporin 2 S256, S264       0.42  
NP_033829 Aqp2 QSVELHS*PQSLPR aquaporin 2 S261       -7.79  
NP_033829 Aqp2 RQSVELHS*PQSLPR aquaporin 2 S261       -6.14  
NP_033829 Aqp2 RRQSVELHS*PQSLPR aquaporin 2 S261          
NP_033829 Aqp2 RQSVELHS*PQS*LPR aquaporin 2 S261, S264          
NP_033829 Aqp2 RQSVELHSPQS*LPR aquaporin 2 S264       3.35  
NP_033829 Aqp2 RQS*VELHSPQSLPRGS*KA aquaporin 2 S256, S269       13.27  
NP_033833 Araf GS*PSPASVSS*GR v-raf murine sarcoma 3611 viral oncogene homolog isoform 1 S255, S263          
NP_848494 Arap2 LES*SKKRS*IK ArfGAP with RhoGAP domain, ankyrin repeat and PH domain 2 S343, S348          
NP_076343 Arfgap2 AIS*SDMFFGR ADP-ribosylation factor GTPase activating protein 2 S431   -1.49 -0.27 0.12  
NP_076343 Arfgap2 AISS*DMFFGR ADP-ribosylation factor GTPase activating protein 2 S432     -0.27    
NP_076343 Arfgap2 HGTDLWIDSMNSAPSHS*PEK ADP-ribosylation factor GTPase activating protein 2 S145          
NP_076343 Arfgap2 HGTDLWIDSMNSAPSHS*PEKK ADP-ribosylation factor GTPase activating protein 2 S145       -0.01  
NP_076343 Arfgap2 Y*KDNPFS*LGETFGS*R ADP-ribosylation factor GTPase activating protein 2 Y357, S363, S370          
NP_001095900 Arfgef1 S*VDIHDSIQPR ADP-ribosylation factor guanine nucleotide-exchange factor 1(brefeldin A-inhibited) S1566   -0.62   -0.30  
NP_001078964 Arfgef2 ELEKPMQSKPQSPVIQATAGS*PK ADP-ribosylation factor guanine nucleotide-exchange factor 2 (brefeldin A-inhibited) S227       -0.07  
NP_001078964 Arfgef2 PQSPVIQATAGS*PK ADP-ribosylation factor guanine nucleotide-exchange factor 2 (brefeldin A-inhibited) S227   -0.09      
NP_001074562 Arfip1 KWS*LNTYK ADP-ribosylation factor interacting protein 1 S132       -0.41  
NP_001139374 Arhgap1 SSS*PEPVTHLK Rho GTPase activating protein 1 isoform 1 S91   0.53   0.07  
NP_001116112 Arhgap17 LGEQGPEPGPTPPQTPT*PPS*TPPLAK nadrin isoform b T736, S739   -1.10   -0.43  
NP_001116112 Arhgap17 LGEQGPEPGPTPPQTPT*PPST*PPLAK nadrin isoform b T736, T740   -0.64   -0.46  
NP_001074833 Arhgap21 VRTS*ASDLSR Rho GTPase activating protein 21 isoform 2 S1848       -0.06  
NP_598476 Arhgap27 KS*S*QDSDTPAQASPPEEK Rho GTPase activating protein 27 isoform 1 S259, S260       1.95  
NP_598476 Arhgap27 KS*SQDS*DTPAQASPPEEK Rho GTPase activating protein 27 isoform 1 S259, S263       1.12  
NP_598476 Arhgap27 KS*SQDSDTPAQASPPEEK Rho GTPase activating protein 27 isoform 1 S259   1.35   1.25  
NP_598476 Arhgap27 KSS*QDSDTPAQASPPEEK Rho GTPase activating protein 27 isoform 1 S260       1.28  
NP_598476 Arhgap27 KSSQDS*DT*PAQASPPEEK Rho GTPase activating protein 27 isoform 1 S263, T265       0.22  
NP_766113 Arhgap29 RSS*DSCPATAVR Rho GTPase activating protein 29 S1149   1.85      
NP_081420 Arhgef12 TDWSSGDASRPSSDSADS*PK Rho guanine nucleotide exchange factor 12 S309   -0.56      
NP_808234 Arhgef15 MLLQNILSQT*EEGS*SR Rho guanine nucleotide exchange factor (GEF) 15 T582, S586          
NP_001106215 Arhgef16 GLNTS*HESDDDILDEPSGPVGTQR Rho guanine nucleotide exchange factor (GEF) 16 S231       -0.05  
NP_001106215 Arhgef16 GLNTSHES*DDDILDEPSGPVGTQR Rho guanine nucleotide exchange factor (GEF) 16 S234       -0.04  
NP_001106215 Arhgef16 HQS*FGAAVLSK Rho guanine nucleotide exchange factor (GEF) 16 S111       -0.06  
NP_001074585 Arhgef17 ALVSPET*PPTPGALRRR Rho guanine nucleotide exchange factor (GEF) 17 T692          
NP_032513 Arhgef2 SVS*TTNIAGHFNDESPLGLR rho/rac guanine nucleotide exchange factor (GEF) 2 S151       -0.19  
NP_032513 Arhgef2 S*LPAGDALYLSFNPPQPSR rho/rac guanine nucleotide exchange factor (GEF) 2 S885   1.62      
NP_032513 Arhgef2 EAQELGS*PEDR rho/rac guanine nucleotide exchange factor (GEF) 2 S931       0.46  
NP_032513 Arhgef2 LQDSSDPDTGSEEEVSSRLS*PPHSPR rho/rac guanine nucleotide exchange factor (GEF) 2 S955   1.48      
NP_032513 Arhgef2 QILSQS*TDSLNMR rho/rac guanine nucleotide exchange factor (GEF) 2 S174   -0.84   0.59  
NP_001106989 Arhgef7 MS*GFIYQGK PAK-interacting exchange factor beta isoform a S497     0.09 -0.49  
NP_001106989 Arhgef7 KPS*DEEFAVR PAK-interacting exchange factor beta isoform a S673   1.30   1.11  
NP_001078824 Arid1b SS*PALAAPDASVDPK AT rich interactive domain 1B (Swi1 like) S1757   0.19      
NP_080310 Armc10 S*AEDLTDGSYDDILNAEQLK SVH protein S43   0.54      
NP_080310 Armc10 S*AEDLTDGSYDDILNAEQLKK SVH protein S43   0.66      
NP_084342 Armcx1 FSFPYKIDDILS*APDLQKVLNILER armadillo repeat containing, X-linked 1 S206          
NP_082146 Armcx3 KEY*KEVILK armadillo repeat containing, X-linked 3 Y298          
NP_001032826 Arnt FARS*DDEQSSADKER aryl hydrocarbon receptor nuclear translocator isoform a S77       0.05  
NP_033840 Art1 IPAMMSLLLVS*VGLR ADP-ribosyltransferase 1 S13          
NP_258435 Arvcf NFDT*LDLPK armadillo repeat gene deleted in velo-cardio-facial syndrome T643   0.72      
NP_258435 Arvcf RTLGS*DSTGDTSEKELLRPDPGR armadillo repeat gene deleted in velo-cardio-facial syndrome S914          
NP_766009 Asxl2 S*ILPS*EAS*PVR polycomb group protein ASXH2 homolog S366, S370, S373          
NP_001025027 Atad5 ADLKES*TITVS*Y*EEFVKSHK ATPase family, AAA domain containing 5 S258, S263, Y264          
NP_001025027 Atad5 LTKPS*LAEENDSRTHATK ATPase family, AAA domain containing 5 S238          
NP_001020264 Atf2 LDLS*PLATPIIR activating transcription factor 2 isoform 1 S94   -0.08      
NP_001020264 Atf2 NDSVIVADQT*PT*PTR activating transcription factor 2 isoform 1 T51, T53   -0.78      
NP_666177 Atf7 TDSVIIADQT*PT*PTR activating transcription factor 7 T51, T53       -1.58  
NP_062299 Atf7ip NKQEDLNSEALS*PSITCDLSSR activating transcription factor 7 interacting protein S112       -0.23  
NP_083930 Atg2b S*SPVCSTAPVETEPK ATG2 autophagy related 2 homolog B S239   -0.01      
NP_083930 Atg2b SS*PVCSTAPVETEPK ATG2 autophagy related 2 homolog B S240   0.01      
NP_080471 Atic VLS*MKFK 5-aminoimidazole-4-carboxamide ribonucleotide formyltransferase/IMP cyclohydrolase S475          
NP_031525 Atm SILEILSKIPDS*Y*QK ataxia telangiectasia mutated S1421, Y1422          
NP_031907 Atn1 RAPS*PGSYK dentatorubral pallidoluysian atrophy S630       0.50  
NP_033858 Atp10a GAISEVCPGDSKRQSTSASQT*AR ATPase, class V, type 10A T1439          
NP_080758 Atp2b1 IEDS*EPHIPLIDDTDAEDDAPTK plasma membrane calcium ATPase 1 S1155   0.86   -0.28  
NP_080758 Atp2b1 IEDS*EPHIPLIDDTDAEDDAPTKR plasma membrane calcium ATPase 1 S1155   0.08   -0.24  
NP_080758 Atp2b1 IEDSEPHIPLIDDT*DAEDDAPTKR plasma membrane calcium ATPase 1 T1165          
NP_080758 Atp2b1 SS*IHNFMTHPEFR plasma membrane calcium ATPase 1 S1140          
NP_031531 Atp5a1 T*GT*AEMS*SILEER ATP synthase, H+ transporting, mitochondrial F1 complex, alpha subunit, isoform 1 T46, T48, S52       8.10  
NP_031531 Atp5a1 T*GT*AEMSS*ILEER ATP synthase, H+ transporting, mitochondrial F1 complex, alpha subunit, isoform 1 T46, T48, S53       8.18  
NP_031531 Atp5a1 TGT*AEMS**SILEER ATP synthase, H+ transporting, mitochondrial F1 complex, alpha subunit, isoform 1 T48, S52          
NP_081715 Atp6ap2 FADDMYS*LYGGNAVVELVTVKS*FDT*SLVR ATPase, H+ transporting, lysosomal accessory protein 2 S254, S269, T272          
NP_081715 Atp6ap2 FADDMYSLY*GGNAVVELVTVKS*FDT*SLVR ATPase, H+ transporting, lysosomal accessory protein 2 Y256, S269, T272          
NP_056618 Atp8a2 LGFVFT*GR ATPase, aminophospholipid transporter-like, class I, type 8A, member 2 T503          
NP_033556 Atrx Y*VESDDEKPTDENVNEK alpha thalassemia/mental retardation syndrome X-linked homolog Y89       0.02  
NP_033556 Atrx YVES*DDEKPTDENVNEK alpha thalassemia/mental retardation syndrome X-linked homolog S92   0.32 -0.21 -0.14  
NP_033150 Atxn1 RWS*APETR ataxin 1 S751       0.59  
NP_033151 Atxn2 ALT*PSIEAK ataxin 2 T710   -0.62 -0.72 -1.12 *
NP_898841 Atxn2l MYPPRS*PK ataxin 2-like S453       0.34  
NP_898841 Atxn2l GAKGS*LPPQR ataxin 2-like S753          
NP_898841 Atxn2l STSTPT*SPGPR ataxin 2-like T686   -0.85      
NP_898841 Atxn2l EKEVDGLLTSDPMGS*PVSSK ataxin 2-like S597   -0.35      
NP_898841 Atxn2l EVDGLLTSDPMGS*PVSSK ataxin 2-like S597   -0.55 -0.39 -0.16  
NP_898841 Atxn2l QGSGRES*PSLVSR ataxin 2-like S337   -1.33   0.36  
NP_898841 Atxn2l TESILDKEDKVPMAGVGGTEGPEQLPAPCPSQTGS*PPVGLIK ataxin 2-like S637   -0.26      
NP_001028608 Atxn7l1 SLTCKTHS*LSHRR ataxin 7-like 1 isoform 1 S315          
NP_780392 Atxn7l2 CST*LKSKAH ataxin 7-like 2 T690          
NP_001028373 AU014645 KTS*DANETEDHLESLICK nuclear cap binding protein subunit 1, 80kDa S22   1.98      
NP_001028383 AU022751 VPVAPSSTT*RS*S*S*DR hypothetical protein LOC102991 T267, S269, S270, S271          
XP_132325 AU042671 TEGT*PPPPGQPAK PREDICTED: hypothetical protein LOC269700 isoform 1 T2273     0.27 -0.09  
NP_808552 AW146020 SNEEDPES*DPDDHEKR hypothetical protein LOC330361 S169       -0.14  
NP_001019773 AW555464 AGS*FTGPSDSETAPAR hypothetical protein LOC217882 S1166   0.49      
NP_001019773 AW555464 LGNTS*PVPR hypothetical protein LOC217882 S478          
NP_001019787 B230208H17Rik EDLS*DVT*DEDTGPAQPPPPSK hypothetical protein LOC227624 S594, T597   0.02      
NP_001019787 B230208H17Rik VAPQQCS*EPETK hypothetical protein LOC227624 S502       -0.34  
NP_001137274 B830028B13Rik KYMT*VPARR hypothetical protein LOC627214 T89          
NP_001137274 B830028B13Rik MVS*KDS*GR hypothetical protein LOC627214 S3, S6          
NP_031548 Bad S*RSAPPNLWAAQR BCL2-associated agonist of cell death S134     0.45 0.47  
NP_031548 Bad S*APPNLWAAQR BCL2-associated agonist of cell death S136   1.81      
NP_031548 Bad SRS*APPNLWAAQR BCL2-associated agonist of cell death S136       1.34  
NP_031548 Bad HSS*YPAGTEEDEGMEEELSPFR BCL2-associated agonist of cell death S112   0.96      
NP_031548 Bad RMS*DEFEGSFK BCL2-associated agonist of cell death S155   0.74   0.70  
NP_038891 Bag3 AAS*PFRS*PVR BCL2-associated athanogene 3 S270, S274       -0.18  
NP_001032843 Baiap2 SS*SMAAGLER brain-specific angiogenesis inhibitor 1-associated protein 2 isoform c S326     0.19 -0.22  
NP_001032843 Baiap2 SSS*MAAGLER brain-specific angiogenesis inhibitor 1-associated protein 2 isoform c S327     0.27 -0.14  
NP_080109 Baiap2l1 DYDTLSKYS*PK BAI1-associated protein 2-like 1 S281       -3.01  
NP_080109 Baiap2l1 MIGKDYDTLS*KYSPK BAI1-associated protein 2-like 1 S278          
NP_080109 Baiap2l1 MIGKDYDTLSKYS*PK BAI1-associated protein 2-like 1 S281       -1.96  
NP_080109 Baiap2l1 SIS*TVDLTEK BAI1-associated protein 2-like 1 S421     0.27 -0.71  
NP_031551 Bard1 KVRY*VVTK BRCA1 associated RING domain 1 Y148          
NP_081671 Basp1 AEPEKS*EGAAEEQPEPAPAPEQEAAAPGPAAGGEAPK brain abundant, membrane attached signal protein 1 S92       -0.51  
NP_064411 Bat2 KQS*SSEISLAVER HLA-B associated transcript 2 S454   1.84      
NP_064411 Bat2 LISGPLS*PMSR HLA-B associated transcript 2 S1217   -1.36      
NP_001074759 Bat2d AFGSGIDIKPGT*PPIGGR BAT2 domain containing 1 T2625   -6.51   -0.78  
NP_001074759 Bat2d STT*PTSSPFR BAT2 domain containing 1 T2634     -0.53    
NP_476512 Bat3 ENAS*PAPGTTAEEAMSR HLA-B-associated transcript 3 S995   -0.06      
NP_035844 Baz1b RQS*LELQK bromodomain adjacent to zinc finger domain, 1B S1338          
NP_035844 Baz1b QMT*LLDMAKGTQKMTRTPR bromodomain adjacent to zinc finger domain, 1B T440          
NP_035844 Baz1b S*SGGVPRSSGKPHK bromodomain adjacent to zinc finger domain, 1B S457          
NP_035844 Baz1b SS*GGVPRSS*GKPHK bromodomain adjacent to zinc finger domain, 1B S458, S465          
NP_081720 Bbx TADGRVS*PAGGTLDDKPK HMG-BOX transcription factor BBX S811     -0.18 0.07  
NP_081720 Bbx TADGRVSPAGGT*LDDKPK HMG-BOX transcription factor BBX T816          
NP_666076 BC002199 SKT*EEDILR hypothetical protein LOC211556 T225       -0.42  
NP_001028403 BC003940 S*PTNSSEIFTPAHEENVR hypothetical protein LOC192173 S21          
NP_001028403 BC003940 SPT*NSSEIFTPAHEENVR hypothetical protein LOC192173 T23          
NP_659134 BC005624 VGDT*EKPEPERSPPNR cDNA sequence BC005624 T253       0.07  
NP_659134 BC005624 VGDTEKPEPERS*PPNR cDNA sequence BC005624 S261   0.08   0.11  
NP_776099 BC027344 SFT*LKS*NLTRHRR hypothetical protein LOC233057 T261, S264          
NP_666055 BC031781 EDGIDAVEVAADRPGS*PR hypothetical protein LOC208768 S269       0.69  
NP_001108487 BC037034 S*QSFSHQQPSR hypothetical protein LOC231807 isoform 1 S515          
NP_001108487 BC037034 SQS*FSHQQPSR hypothetical protein LOC231807 isoform 1 S517       -0.57  
XP_001481366 BC039210 RALPAHPGASS*GWR PREDICTED: similar to hCG1980844 S1546          
XP_150243 BC042396 RIS*QVS*SGETEYNPGEAR mKIAA0540 protein S2757, S2760       0.19  
XP_150243 BC042396 RIS*QVSS*GETEYNPGEAR mKIAA0540 protein S2757, S2761       0.19  
NP_038895 Bcar3 TGEALRGS*DSQLCPKPPPKPCK breast cancer anti-estrogen resistance 3 S390       -0.71  
NP_038895 Bcar3 TGS*EPTLSPALVR breast cancer anti-estrogen resistance 3 S365     0.61 1.01  
NP_031559 Bckdha IGHHS*TSDDSSAYR branched chain keto acid dehydrogenase E1, alpha polypeptide S338   0.85   -0.30  
NP_031559 Bckdha IGHHST*SDDSSAYR branched chain keto acid dehydrogenase E1, alpha polypeptide T339       -0.30  
NP_033869 Bckdk S*TSATDTHHVELAR branched chain ketoacid dehydrogenase kinase S31       0.92  
NP_033869 Bckdk ST*SATDTHHVELAR branched chain ketoacid dehydrogenase kinase T32   0.63   -0.01  
NP_033869 Bckdk STS*ATDTHHVELAR branched chain ketoacid dehydrogenase kinase S33          
NP_705736 Bcl2l13 AEKT*SPTPSVFVELGEEELEAVTARPEAVER BCL2-like 13 T342       -0.16  
NP_705736 Bcl2l13 AEKTS*PTPSVFVELGEEELEAVTARPEAVER BCL2-like 13 S343       -0.15  
NP_705736 Bcl2l13 T*SPTPSVFVELGEEELEAVTARPEAVER BCL2-like 13 T342   0.56      
NP_084532 Bcl9l EAPGS*PPLS*PR B-cell CLL/lymphoma 9-like S21, S25   -1.16      
NP_084532 Bcl9l ERS*VSVDSGEQR B-cell CLL/lymphoma 9-like S116       0.43  
NP_001020563 Bclaf1 KAEGEPQEES*PLK BCL2-associated transcription factor 1 isoform 1 S177   -0.06   0.14  
NP_001020563 Bclaf1 KAEGEPQEES*PLKSK BCL2-associated transcription factor 1 isoform 1 S177       -0.30  
NP_001020563 Bclaf1 SATSGDIWPGLSAYDNS*PR BCL2-associated transcription factor 1 isoform 1 S221   -0.03      
NP_001020563 Bclaf1 YS*PSQNSPIHHIPSR BCL2-associated transcription factor 1 isoform 1 S284          
NP_001020563 Bclaf1 YS*PS*QNSPIHHIPSR BCL2-associated transcription factor 1 isoform 1 S284, S286       0.09  
NP_001020563 Bclaf1 YS*PSQNS*PIHHIPSR BCL2-associated transcription factor 1 isoform 1 S284, S289   -0.38   -0.03  
NP_001020563 Bclaf1 YSPS*QNS*PIHHIPSR BCL2-associated transcription factor 1 isoform 1 S286, S289       0.40  
NP_001020563 Bclaf1 LRCDS*ADLR BCL2-associated transcription factor 1 isoform 1 S688          
NP_001020563 Bclaf1 LLAST*LVHS*VKK BCL2-associated transcription factor 1 isoform 1 T572, S576          
NP_001020563 Bclaf1 ADGDWDDQEVLDY*FSDKESAK BCL2-associated transcription factor 1 isoform 1 Y381       -0.17  
NP_001020563 Bclaf1 ADGDWDDQEVLDYFS*DKESAK BCL2-associated transcription factor 1 isoform 1 S383   0.48   -0.16  
NP_001020563 Bclaf1 ADGDWDDQEVLDYFSDKES*AK BCL2-associated transcription factor 1 isoform 1 S387   -0.34      
NP_001020563 Bclaf1 ELFDYS*PPLHK BCL2-associated transcription factor 1 isoform 1 S510   0.11   0.05  
NP_001020563 Bclaf1 EVQS*PEQVK BCL2-associated transcription factor 1 isoform 1 S494   -0.08      
NP_001020563 Bclaf1 FHDS*EGDDTEETEDYR BCL2-associated transcription factor 1 isoform 1 S395   0.26   -0.10  
NP_001020563 Bclaf1 IDIS*PSALR BCL2-associated transcription factor 1 isoform 1 S656   -0.01 0.09 0.07  
NP_001020563 Bclaf1 KEVQS*PEQVK BCL2-associated transcription factor 1 isoform 1 S494   -0.97      
NP_001020563 Bclaf1 KEVQS*PEQVKSEK BCL2-associated transcription factor 1 isoform 1 S494       -0.15  
NP_001020563 Bclaf1 LKELFDY*SPPLHK BCL2-associated transcription factor 1 isoform 1 Y509   -0.08      
NP_001020563 Bclaf1 LKELFDYS*PPLHK BCL2-associated transcription factor 1 isoform 1 S510   -0.03   0.57  
NP_001020563 Bclaf1 RIDIS*PSALR BCL2-associated transcription factor 1 isoform 1 S656   -0.07   0.39  
NP_001020563 Bclaf1 RIDISPS*ALR BCL2-associated transcription factor 1 isoform 1 S658       0.15  
NP_001020563 Bclaf1 SIFREES*PLR BCL2-associated transcription factor 1 isoform 1 S529     0.65 0.97  
NP_001020563 Bclaf1 SIFREES*PLRIK BCL2-associated transcription factor 1 isoform 1 S529          
NP_001020563 Bclaf1 TIT*PQNAPR BCL2-associated transcription factor 1 isoform 1 T305       -0.23  
NP_001020563 Bclaf1 Y*SPSQNS*PIHHIPSR BCL2-associated transcription factor 1 isoform 1 Y283, S289   -0.50      
NP_001074881 Bcr ASAPRPPPAPADGADPAPVEESEARPDGEGS*PSK breakpoint cluster region S122       -0.62  
NP_033881 Bfsp1 KEAEGS*R beaded filament structural protein 1, in lens-CP94 S563          
NP_001106267 Bicd1 T*SSEPVSKENTET*S*K bicaudal D homolog 1 isoform 1 T576, T588, S589          
NP_001076803 Bin1 GNKSPS*PPPDGS*PAATPEIR bridging integrator 1 isoform 2 S267, S273       0.01  
NP_001035992 Blm QQSKGTCSEPSLPAT*VQT*AQDT*LCTTPKTPT*AK Bloom syndrome protein homolog isoform 2 T111, T114, T118, T127          
NP_033885 Bmp1 ISVT*PGEK bone morphogenetic protein 1 T360     -0.12    
NP_033885 Bmp1 YEVNGVKPS*IGQRTR bone morphogenetic protein 1 S303          
NP_033889 Bmx MSPNNYKERLFVLT*K BMX non-receptor tyrosine kinase T38          
NP_001008239 Bnip2 KGS*ITEYTATEEK BCL2/adenovirus E1B interacting protein 2 isoform alpha S114   0.29   0.27  
NP_033890 Bnip3 NSTLS*EEDYIER BCL2/adenovirus E1B interacting protein 3 S88   >10      
NP_033891 Bnip3l NGGLEHVPS*SSSIHNGDMEK BCL2/adenovirus E1B interacting protein 3-like S61       0.37  
NP_033891 Bnip3l NGGLEHVPSS*SSIHNGDMEK BCL2/adenovirus E1B interacting protein 3-like S62          
NP_033891 Bnip3l NGGLEHVPSSS*SIHNGDMEK BCL2/adenovirus E1B interacting protein 3-like S63       0.50  
NP_033891 Bnip3l NGGLEHVPSSSS*IHNGDMEK BCL2/adenovirus E1B interacting protein 3-like S64       0.60  
NP_001074891 Bod1l YYS*DS*DDELTVEQR biorientation of chromosomes in cell division 1-like S480, S482          
NP_001074891 Bod1l KLSSQPS*TDVSTDKER biorientation of chromosomes in cell division 1-like S240          
NP_001074891 Bod1l S*KAQLS*PSVKR biorientation of chromosomes in cell division 1-like S2995, S3000          
NP_033894 Brca1 VVRS*IQERR breast cancer 1 S1665          
NP_001028446 Brd1 VHGEPASDLS*DID bromodomain containing 1 S1186          
NP_001020558 Brd2 KADTTTPTPTAILAPGS*PAS*PPGSLEPK bromodomain containing 2 isoform b S178, S181       -0.25  
NP_001107045 Brd3 SES*PPPLSEPK bromodomain containing 3 isoform 2 S262   -0.09 0.51 0.20  
NP_065254 Brd4 IHS*PIIR bromodomain containing 4 isoform 1 S1153   -2.16   -0.21  
NP_065254 Brd4 HPT*TPSSTAK bromodomain containing 4 isoform 1 T1247          
NP_065254 Brd4 FAKMPDEPEEPVVTVSS*PAVPPPTK bromodomain containing 4 isoform 1 S471       -4.02  
NP_065254 Brd4 TKPPPTYES*EEEDK bromodomain containing 4 isoform 1 S602   -0.27      
NP_082469 Brf1 GGGS*PPRDDSQPPER transcription initiation factor IIIB S552   0.17   -0.81  
NP_082469 Brf1 GGGSPPRDDS*QPPER transcription initiation factor IIIB S558       -0.12  
NP_001003920 Brsk1 GGGSPT*S*K BR serine/threonine kinase 1 T472, S473          
NP_536706 Bsnd KQQWS*LR Bartter syndrome, infantile, with sensorineural deafness (Barttin) S260          
NP_666112 Bud13 ARHDT*PDPS*PPR BUD13 homolog T144, S148       0.19  
NP_666112 Bud13 HDLDAS*PPR BUD13 homolog S238   -0.24   0.20  
NP_666112 Bud13 HDT*PDLS*PPR BUD13 homolog T196, S200       -0.06  
NP_666112 Bud13 HDT*PDPS*PPR BUD13 homolog T144, S148       0.04  
NP_666112 Bud13 HDT*PDPS*PPRK BUD13 homolog T144, S148       -0.02  
NP_666112 Bud13 HDT*PDPS*PPRR BUD13 homolog T183, S187       0.62  
NP_666112 Bud13 HDT*PDT*SPPR BUD13 homolog T131, T134       0.32  
NP_666112 Bud13 HDT*PDTS*PPR BUD13 homolog T131, S135       0.20  
NP_666112 Bud13 HDTPDPS*PPR BUD13 homolog S148   0.15   -0.44  
NP_666112 Bud13 HDTPDT*SPPR BUD13 homolog T134       0.19  
NP_666112 Bud13 HDTPDTS*PPR BUD13 homolog S135   0.69   0.19  
NP_666112 Bud13 KSHRNSS*AVSPR BUD13 homolog S248       0.90  
NP_666112 Bud13 VRHDT*PDLS*PPR BUD13 homolog T196, S200       0.15  
NP_666112 Bud13 VRHDT*PDPS*PPR BUD13 homolog T222, S226       0.08  
NP_666112 Bud13 VRHDT*PDTS*PPR BUD13 homolog T131, S135       0.11  
NP_666112 Bud13 YEHDS*DLS*PPR BUD13 homolog S341, S344       0.27  
NP_666112 Bud13 YEHDSDLS*PPR BUD13 homolog S344   -0.36      
NP_080100 Bzw1 NAEEES*ESEAEEGD basic leucine zipper and W2 domains 1 S411          
NP_001156973 C130039O16Rik SFEPPPYT*PPPILS*PVR hypothetical protein LOC238317 T647, S653   0.36      
NP_780733 C130060K24Rik HGSS*GAMVMHRR hypothetical protein LOC243407 S364          
NP_031598 C1qa VWT*VAEDVCR complement component 1, q subcomponent, A chain T20   -0.30      
XP_001478255 C230057M02Rik WTLAISS*ASGCTRPDPT*NKT*HGR PREDICTED: hypothetical protein LOC319463 S57, T67, T70          
NP_780495 C430004E15Rik KAPGNY*PLAGR hypothetical protein LOC97031 Y383          
NP_780495 C430004E15Rik NGQEPVRPGLPVTFIDEVDS*EEEAFQEAK hypothetical protein LOC97031 S501   0.20   -0.24  
NP_780495 C430004E15Rik WQRPAS*PPPFLPATAEAEPAEGLGVPGLAK hypothetical protein LOC97031 S457   0.10   -0.52  
NP_780663 C630004H02Rik T*GSQEGTSMEGSRPAAPAEPGTLK hypothetical protein LOC217310 T591   0.00      
NP_780663 C630004H02Rik TGS*QEGTSMEGSRPAAPAEPGTLK hypothetical protein LOC217310 S593     -1.13 0.85  
NP_001028361 C77080 GLAVAPAS*PGK hypothetical protein LOC97130 S600     -2.49 -0.48  
NP_001028361 C77080 GS*PSGGSTAETSDTASIR hypothetical protein LOC97130 S459   0.65      
NP_001039024 C920016K16Rik QRMEPVT*FEDVAVNFS*LGEWALLDSS*QK hypothetical protein LOC240067 T11, S20, S30          
NP_653115 Cabp4 S*KKESWHPGS*QK calcium binding protein 4 S37, S46   11.28      
NP_033912 Cacna1e RSYHSS*LR calcium channel, voltage-dependent, R type, alpha 1E subunit S2017          
NP_076014 Cad RLS*SFVTK carbamoyl-phosphate synthetase 2, aspartate transcarbamylase, and dihydroorotase S1406   4.27   1.77  
NP_076014 Cad AS*DPGLPAEEPK carbamoyl-phosphate synthetase 2, aspartate transcarbamylase, and dihydroorotase S1859   0.64      
NP_076014 Cad IHRAS*DPGLPAEEPK carbamoyl-phosphate synthetase 2, aspartate transcarbamylase, and dihydroorotase S1859   0.75   -0.27  
NP_076014 Cad Y*VAPPS*LRMPPS*VR carbamoyl-phosphate synthetase 2, aspartate transcarbamylase, and dihydroorotase Y2103, S2108, S2114          
NP_663550 Cald1 LKQTENAFS*PSR caldesmon 1 S248       -0.02  
NP_081692 Calml3 EAFSLFDKDGDGS*IT*T* calmodulin-like 3 S27, T29, T30          
NP_081692 Calml3 EAFSLFDKDGDGS*ITT* calmodulin-like 3 S27, T30          
NP_081692 Calml3 EAFSLFDKDGDGS*ITT* calmodulin-like 3 S27, T30          
NP_081692 Calml3 EAFSLFDKDGDGSIT*T* calmodulin-like 3 T29, T30          
NP_001020609 Camk2d KPDGVKES*TESSNTT*IEDEDVK calcium/calmodulin-dependent protein kinase II, delta isoform 2 S330, T337       0.02  
NP_001020609 Camk2d KPDGVKES*TESSNTTIEDEDVK calcium/calmodulin-dependent protein kinase II, delta isoform 2 S330       -0.19  
NP_001020609 Camk2d KPDGVKEST*ESSNTTIEDEDVK calcium/calmodulin-dependent protein kinase II, delta isoform 2 T331       0.06  
NP_663333 Camkk2 S*FGNPFEGSR calcium/calmodulin-dependent protein kinase kinase 2, beta S495     2.53    
NP_663333 Camkk2 SLS*APGNLLTK calcium/calmodulin-dependent protein kinase kinase 2, beta S511     5.23    
NP_663333 Camkk2 KMS*LQEPSQGGPASSSNSLDMNGR calcium/calmodulin-dependent protein kinase kinase 2, beta S99       3.39  
NP_001103969 Canx AEEDEILNRS*PR calnexin S582   0.80 0.95 0.20 *
NP_001103969 Canx QKS*DAEEDGVT*GSQDEEDSKPK calnexin S553, T561       -0.17  
NP_001103969 Canx QKS*DAEEDGVTGS*QDEEDSKPK calnexin S553, S563          
NP_001103969 Canx QKS*DAEEDGVTGS*QDEEDSKPK calnexin S553, S563       0.09  
NP_001103969 Canx QKS*DAEEDGVTGSQDEEDSKPK calnexin S553          
NP_001103969 Canx QKS*DAEEDGVTGSQDEEDSKPK calnexin S553     0.27 0.06  
NP_001103969 Canx SDAEEDGVT*GSQDEEDSKPK calnexin T561       0.20  
NP_001103969 Canx SDAEEDGVTGS*QDEEDSKPK calnexin S563   1.28   0.09  
NP_001035999 Capg YSPNTQVEILPQGRES*PIFK gelsolin-like capping protein isoform 2 S338       -0.24  
NP_001104759 Caprin1 SLT*PVAQSDPLVR cytoplasmic activation/proliferation-associated protein 1 isoform a T343   -0.93      
NP_631889 Carf GY*CVSETELES*VLT*FHK calcium response factor Y197, S206, T209          
NP_080097 Carhsp1 GNVVPS*PLPTR calcium-regulated heat-stable protein (24kD) S42   -0.60 -0.15 0.17  
NP_080097 Carhsp1 GNVVPS*PLPTRR calcium-regulated heat-stable protein (24kD) S42       0.10  
NP_080097 Carhsp1 VVPS*PLPTR calcium-regulated heat-stable protein (24kD) S42     -0.08    
NP_080097 Carhsp1 TFS*ATVR calcium-regulated heat-stable protein (24kD) S53   0.06 0.07 -0.06  
NP_080097 Carhsp1 TFSAT*VR calcium-regulated heat-stable protein (24kD) T55          
NP_080097 Carhsp1 DRS*PS*PLRGNVVPSPLPTR calcium-regulated heat-stable protein (24kD) S31, S33          
NP_619601 Casc3 FGS*SPQRDPNWIGDR cancer susceptibility candidate 3 S262   -0.08      
NP_619601 Casc3 GTVT*GERQSGDGQESTEPVENK cancer susceptibility candidate 3 T140       0.09  
NP_619601 Casc3 GTVTGERQS*GDGQESTEPVENK cancer susceptibility candidate 3 S145   0.22   -0.15  
NP_083893 Casc5 RVS*FADTIK cancer susceptibility candidate 5 S60   0.78      
NP_001073595 Casp8 RMS*LEGR caspase 8 S188       2.09  
NP_033947 Cast EQKPFTPAS*PVQSTPSKPSDK calpastatin S185     -1.03 -0.90  
NP_033953 Cbfa2t2 DT*VPPEPPAKR core-binding factor, runt domain, alpha subunit 2, translocated to, 2 homolog isoform 2 T241          
NP_001070257 Cbx5 KS*SFSNSADDIK chromobox homolog 5 S92   2.81   1.12  
NP_001070257 Cbx5 KSS*FSNSADDIK chromobox homolog 5 S93   2.73 1.42 1.50 *
NP_001070257 Cbx5 KSSFS*NSADDIK chromobox homolog 5 S95       1.31  
NP_001070257 Cbx5 S*SFSNSADDIK chromobox homolog 5 S92   3.13 1.38 1.25  
NP_001070257 Cbx5 SS*FSNSADDIK chromobox homolog 5 S93   2.80 1.54 1.40 *
NP_001070257 Cbx5 SSFS*NSADDIK chromobox homolog 5 S95          
NP_083039 Cbx6 VAAGVAGAT*GGGGGTGPSK chromobox homolog 6 T404   3.42      
NP_666082 Cc2d1a LANHDEGS*DDEEEETPK coiled-coil and C2 domain containing 1A S435       0.08  
NP_666082 Cc2d1a LANHDEGS*DDEEEETPKK coiled-coil and C2 domain containing 1A S435       -0.09  
NP_081906 Ccdc105 FNQEMY*VTRGIIK coiled-coil domain containing 105 Y372     #####    
NP_001028418 Ccdc110 ERLIKAEQES*LLHS*LDT*AK coiled-coil domain containing 110 S640, S644, T647          
NP_082588 Ccdc12 GQEDSLASAVDATTGQEACDS*D coiled-coil domain containing 12 S165          
NP_082588 Ccdc12 LKGQEDSLASAVDATTGQEACDS*D coiled-coil domain containing 12 S165       -0.09  
NP_084215 Ccdc151 KNQDT*INQLQEET*K coiled-coil domain containing 151 T97, T105          
NP_666056 Ccdc25 VENMSSNQDGNDS*DEFM coiled-coil domain containing 25 S204          
NP_083080 Ccdc3 S*LRQARKNSR coiled-coil domain containing 3 S227          
NP_080194 Ccdc43 AALLAQYADVT*DEEDEADKKDDAGASTANVSSDR coiled-coil domain containing 43 T137   0.68   -0.72  
NP_080194 Ccdc43 KAALLAQYADVT*DEEDEADKKDDAGASTANVSSDR coiled-coil domain containing 43 T137       -0.74  
NP_001104591 Ccdc6 LDQPVS*APPS*PR coiled-coil domain containing 6 S233, S237   0.17 -0.23 -0.28  
NP_001104591 Ccdc6 LDQPVSAPPS*PR coiled-coil domain containing 6 S237   -1.26      
NP_851289 Ccdc79 DIS*EKET**LR coiled-coil domain containing 79 S396, T400          
NP_997151 Ccdc87 T*S*TPKPVPEK coiled-coil domain containing 87 T554, S555          
NP_082657 Ccdc94 LLEDS*ES*EDEAPPSRPR coiled-coil domain containing 94 S211, S213       0.07  
NP_081687 Ccdc99 Y*QSLKKQNAFTR coiled-coil domain containing 99 Y279     4.99 4.06  
NP_081687 Ccdc99 YQS*LKKQNAFTR coiled-coil domain containing 99 S281     5.27    
NP_035463 Ccl2 MIPMSRLESY*KR chemokine (C-C motif) ligand 2 Y51          
NP_898836 Ccnb3 KIS*LVSNVVT*T*K cyclin B3 S250, T257, T258     -6.07 -7.12  
NP_001032211 Ccne2 S*VSPVKLKTFKK cyclin E2 isoform 1 S337          
NP_033962 Ccnk KPS*PQPS*PPR cyclin K S325, S329   0.50   -0.12  
NP_064321 Ccnl1 AEEKS*PVSINVK cyclin L1 S358   0.09   0.28  
NP_997561 Ccnl2 AQGHS*PVNGLLK cyclin L2 S366   1.47      
NP_080760 Ccny S*ASADNLILPR cyclin fold protein 1 S324          
NP_080760 Ccny SAS*ADNLILPR cyclin fold protein 1 S326     0.36    
NP_001107800 Ccpg1 RGSRGS*HRAK cell cycle progression 1 isoform 1 S473          
NP_058588 Ccs KDS*AQPPAHL copper chaperone for superoxide dismutase S267          
NP_033977 Cd2ap AEADDGKRNS*VDELR CD2-associated protein S580       0.55  
NP_033977 Cd2ap FNGGHS*PTQS*PEK CD2-associated protein S510, S514       -0.57  
NP_033977 Cd2ap FNGGHS*PTQSPEK CD2-associated protein S510       -0.98  
NP_033977 Cd2ap FNGGHSPT*QSPEK CD2-associated protein T512          
NP_033977 Cd2ap S*VDLDAFVAR CD2-associated protein S458   -2.05 -0.22 -0.55  
NP_033977 Cd2ap T*SSSETEEKKTEKPLILQPLGSR CD2-associated protein T231       -0.36  
NP_033977 Cd2ap TSS*SETEEKKTEKPLILQPLGSR CD2-associated protein S233       -0.38  
NP_001034239 Cd44 DS*RGSS*R CD44 antigen isoform b S448, S452     #####    
NP_031685 Cdc2a IGEGT*Y*GVVYK cell division cycle 2 T14, Y15     0.28 -0.21  
NP_031685 Cdc2a IGEGT*YGVVYK cell division cycle 2 T14   0.18      
NP_031685 Cdc2a IGEGTY*GVVYK cell division cycle 2 Y15   -0.07 0.22 0.16  
NP_031685 Cdc2a VYT*HEVVTLWYR cell division cycle 2 T161       0.67  
NP_031687 Cdc2l1 RDS*LEEGELR cell division cycle 2-like 1 S47          
NP_031687 Cdc2l1 AYT*PVVVTLWYR cell division cycle 2-like 1 T584   -0.68      
NP_001074527 Cdc2l5 CLLADLPLPPELPGGDDLSKS*PEEK cell division cycle 2-like 5 (cholinesterase-related cell division controller) isoform 1 S664   -7.80      
NP_001074527 Cdc2l5 ILELT*PEPDRPR cell division cycle 2-like 5 (cholinesterase-related cell division controller) isoform 1 T1245   -0.17      
NP_898837 Cdc42bpb HSTPSNSSNPS*GPPS*PNSPHR CDC42 binding protein kinase beta S1688, S1692          
NP_898837 Cdc42bpb HSTPSNSSNPSGPPS*PNSPHR CDC42 binding protein kinase beta S1692   0.15   -0.08  
NP_898837 Cdc42bpb HSTPSNSSNPSGPPSPNS*PHR CDC42 binding protein kinase beta S1695   -0.09   -0.11  
NP_898837 Cdc42bpb SS*SLGSRTLDPLWKVR CDC42 binding protein kinase beta S852   -12.69      
NP_001028514 Cdc42bpg SSGPQRPHS*FSEAFR CDC42 binding protein kinase gamma (DMPK-like) S1481       -0.57  
NP_081495 Cdc42ep1 RSDS*LLSFR CDC42 effector protein (Rho GTPase binding) 1 S207       0.41  
NP_001155095 Cdc45l VLLFVAS*DVDALCACK cell division cycle 45 homolog (S. cerevisiae)-like isoform 2 S25          
NP_001103632 Cdca2 RRISSQDSPDNYLS*GTK cell division cycle associated 2 S216          
NP_001103632 Cdca2 S*PAT*PVCGSS*TPS*AKTFVLRSVLKKPGK cell division cycle associated 2 S306, T309, S315, S318          
NP_666152 Cdca7l T*PPSASRRR transcription factor RAM2 T234       -0.01  
NP_064656 Cdgap MHASSTGSS*CDLSK Cdc42 GTPase-activating protein S385          
NP_034000 Cdk4 ALQHSYLHKEES*DAE cyclin-dependent kinase 4 S300       -0.05  
NP_034005 Cdkn1b VSNGS*PSLER cyclin-dependent kinase inhibitor 1B S10   -0.58      
NP_034005 Cdkn1b VSNGSPS*LER cyclin-dependent kinase inhibitor 1B S12   -0.39 -0.66    
NP_034007 Cdkn2a WVVFVY*R cyclin-dependent kinase inhibitor 2A isoform 1 Y159     -0.01    
NP_031700 Cdx4 T*VQVTGKTRTKEK caudal type homeo box 4 T161       4.92  
NP_001004177 Celsr2 LTVEAS*DQGR cadherin EGF LAG seven-pass G-type receptor 2 isoform 2 S370          
NP_776123 Cenpe ETKTQKELSVT*VRTK centromere protein E T1970          
NP_776123 Cenpe S*LPSEVET*LRR centromere protein E S751, T758       1.70  
NP_001123471 Cep250 ET*MTSSPTQQDGRGSQR centrosomal protein 2 isoform 2 T2318          
NP_001123471 Cep250 ETMTS*SPTQQDGRGSQR centrosomal protein 2 isoform 2 S2321          
NP_001074591 Cep63 LQT*TLKAVGT*QQS*VERPLEDCQK centrosomal protein 63 T352, T359, S362          
NP_062278 Cetn2 RMS*PKPELTEDQKQEIR centrin 2 S20       -0.28  
NP_001032800 Cgn HSQS*PDSGKESLLK cingulin S446       -0.58  
NP_001032800 Cgn ST*SLLELAPKPTSSINTIDTAPLSSVDSLINK cingulin T149   1.13      
NP_001032800 Cgn STS*LLELAPKPTSSINTIDTAPLSSVDSLINK cingulin S150   0.42      
NP_080875 Cgnl1 RQDS*AGPILDGAR cingulin-like 1 S284   -0.27   0.33  
NP_080875 Cgnl1 SS*SSSTTPTSATSLYK cingulin-like 1 S298   0.70      
NP_080875 Cgnl1 SYGS*QPNS*PTSEDLAK cingulin-like 1 S199, S203       0.07  
NP_082359 Chaf1b TQDPSSPCT*TPSPTTQSPAPSAIK chromatin assembly factor 1 subunit B T439   -0.94      
NP_001074814 Chd2 ENKEKPVS*SRKDR chromodomain helicase DNA binding protein 2 S1406          
NP_666131 Chd3 MEAEVDS*PSPAPSLGER chromodomain helicase DNA binding protein 3 S1651          
NP_666131 Chd3 TSPTT*PEASTT*NSPCTSKPATPAPSEK chromodomain helicase DNA binding protein 3 T1593, T1599   0.47      
NP_666131 Chd3 TSPTT*PEASTTNS*PCTSKPATPAPSEK chromodomain helicase DNA binding protein 3 T1593, S1601   0.47      
NP_666091 Chd4 KMS*QPGS*PSPK chromodomain helicase DNA binding protein 4 S1524, S1528   1.54      
NP_666091 Chd4 MSQPGS*PSPK chromodomain helicase DNA binding protein 4 S1528   -0.26      
NP_613051 Cherp S*RS*PT*PPSAAGLGSNSAPPIPDSR SR-related CTD associated factor 6 S826, S828, T830       -0.13  
NP_613051 Cherp S*RS*PTPPS*AAGLGSNSAPPIPDSR SR-related CTD associated factor 6 S826, S828, S833       -0.13  
NP_081155 Chmp2b ATIS*DEEIER chromatin modifying protein 2B S199       -0.10  
NP_444298 Chrac1 REEEEDNEDDGS*DLGEALA chromatin accessibility complex 1 S122       0.39  
NP_082204 Chst13 LFQDIS*PFYQRR carbohydrate sulfotransferase 13 S307          
NP_082759 Cib4 SPDFMNS*FR calcium and integrin binding family member 4 S177   0.23      
NP_001103601 Cic KVFS*PVIR capicua homolog isoform b S496       -3.17  
NP_001103601 Cic SS*PPPPLPAEERPGTK capicua homolog isoform b S1241          
NP_031734 Cit IRS*LEQR citron S817       0.74  
NP_001074745 Clasp1 S*RSDIDVNAAASAK CLIP-associating protein 1 isoform 1 S598   0.54      
NP_001074745 Clasp1 RQS*SGSTTNVASTPSDSR CLIP-associating protein 1 isoform 1 S646   1.22      
NP_001074745 Clasp1 RQSS*GSTTNVASTPSDSR CLIP-associating protein 1 isoform 1 S647       1.49  
NP_001074745 Clasp1 RQSSGST*TNVASTPSDSR CLIP-associating protein 1 isoform 1 T650       1.94  
NP_059502 Clca3 SEIS*NIAR chloride channel calcium activated 3 S857   0.00      
NP_035464 Clcn4-2 TLAT*DVMRPR chloride channel 4 T584          
NP_001038985 Clint1 ASPDQNASTHT*PQSSAKPSVPSSK clathrin interactor 1 T308   -3.17      
NP_001034251 Clip2 KIS*GTTALQEALK cytoplasmic linker 2 isoform b S353   5.65      
NP_031739 Clk3 YRS*PEPDPYLSYR CDC-like kinase 3 S157   0.66      
NP_001035772 Clmn S*HSEEGLDFKPSPPLSK calmin isoform b S713       0.59  
NP_001035772 Clmn SHSEEGLDFKPS*PPLSK calmin isoform b S724       -0.36  
NP_001035772 Clmn SHSEEGLDFKPSPPLS*K calmin isoform b S728       -0.36  
NP_780763 Clspn LKTNGS*SPGPKR claspin S1301          
NP_001003908 Cltc LECSEELGDLVKSVDPT*LALSVYLR clathrin, heavy polypeptide (Hc) T473          
NP_084014 Cluap1 KPEPLDES*DNDF clusterin associated protein 1 S409       0.16  
NP_001028664 CN716893 DKAEAKVTLVDS*S*CK hypothetical protein LOC434903 S343, S344          
NP_001103215 Cnbp CYS*CGEFGHIQK cellular nucleic acid binding protein isoform 2 S115          
NP_001103215 Cnbp CGET*GHVAINCSK cellular nucleic acid binding protein isoform 2 T137          
NP_766134 Cnksr3 APFTGITDLS*VTK Cnksr family member 3 S150   31.08      
NP_291048 Cnnm4 GNT*SGMLVVIT*KFLR cyclin M4 T125, T133          
NP_001032935 Cnot2 TNSMSSSGLGS*PNR CCR4-NOT transcription complex, subunit 2 isoform a S165   -1.05   -0.48  
NP_058062 Cntnap1 Y*KGS*YHTNEPK contactin associated protein 1 Y1312, S1315          
NP_766084 Cobl TPGNCEPPHS*PK cordon-bleu protein S1128       -0.67  
NP_081501 Cobll1 ADDDIIQKPAETS*PPPVAPK Cobl-like 1 isoform 2 S958   0.24   -0.10  
NP_081501 Cobll1 AET*SPPPVAAKPVALPGSQGTSLNLK Cobl-like 1 isoform 2 T1021   -0.34      
NP_081501 Cobll1 AETS*PPPVAAKPVALPGSQGTSLNLK Cobl-like 1 isoform 2 S1022   0.22   -0.28  
NP_081501 Cobll1 AETS*PPPVFPK Cobl-like 1 isoform 2 S974   -0.12      
NP_081501 Cobll1 DPQLS*PEQHPSSLSER Cobl-like 1 isoform 2 S923       -0.03  
NP_081501 Cobll1 EQTAS*APAT*PLVSK Cobl-like 1 isoform 2 S268, T272   -1.47 -2.47 -3.10 *
NP_081501 Cobll1 EQTAS*APATPLVSK Cobl-like 1 isoform 2 S268   -2.99 -1.49 -1.71 *
NP_081501 Cobll1 EVQRDPQLS*PEQHPSSLSER Cobl-like 1 isoform 2 S923       -0.19  
NP_081501 Cobll1 ITVEKDPDSALGIS*DGET*SPSSK Cobl-like 1 isoform 2 S476, T480       -0.41  
NP_081501 Cobll1 ITVEKDPDSALGIS*DGETS*PSSK Cobl-like 1 isoform 2 S476, S481       -0.43  
NP_081501 Cobll1 ITVEKDPDSALGIS*DGETSPSSK Cobl-like 1 isoform 2 S476       -0.27  
NP_081501 Cobll1 LPEKEPACTYGNNVPLS*PVDGSNKNPAASYLK Cobl-like 1 isoform 2 S700   -0.23      
NP_081501 Cobll1 QS*S*LTFQSSDPEHVR Cobl-like 1 isoform 2 S1144, S1145          
NP_081501 Cobll1 QS*SLT*FQSSDPEHVR Cobl-like 1 isoform 2 S1144, T1147          
NP_081501 Cobll1 QS*SLTFQSSDPEHVR Cobl-like 1 isoform 2 S1144          
NP_081501 Cobll1 QS*SLTFQSSDPEHVR Cobl-like 1 isoform 2 S1144          
NP_081501 Cobll1 QSS*LTFQSSDPEHVR Cobl-like 1 isoform 2 S1145          
NP_081501 Cobll1 QSS*LTFQSSDPEHVR Cobl-like 1 isoform 2 S1145   0.07   0.00  
NP_081501 Cobll1 RQS*SLTFQSSDPEHVR Cobl-like 1 isoform 2 S1144       -0.16  
NP_081501 Cobll1 RQSS*LTFQSSDPEHVR Cobl-like 1 isoform 2 S1145       -0.16  
NP_081501 Cobll1 RQSSLT*FQSSDPEHVR Cobl-like 1 isoform 2 T1147       -0.17  
NP_081501 Cobll1 ST*SVDDTDKSSSEAIMVR Cobl-like 1 isoform 2 T333       -0.72  
NP_081501 Cobll1 STS*VDDTDKSSSEAIMVR Cobl-like 1 isoform 2 S334   -0.30 -0.62 -0.55 *
NP_081501 Cobll1 STSVDDT*DKSSSEAIMVR Cobl-like 1 isoform 2 T338       -0.80  
NP_081501 Cobll1 T*GSLQLSSTSIGTSSLK Cobl-like 1 isoform 2 T350   0.69      
NP_081501 Cobll1 T*LSSPTGTETNPPK Cobl-like 1 isoform 2 T824          
NP_081501 Cobll1 TGS*LQLSSTSIGTSSLK Cobl-like 1 isoform 2 S352   0.65      
NP_081501 Cobll1 TLS*SPTGTETNPPK Cobl-like 1 isoform 2 S826   -0.10 -0.54 -0.17  
NP_081501 Cobll1 TLS*SPTGTETNPPKAPR Cobl-like 1 isoform 2 S826       -0.20  
NP_081501 Cobll1 TLSS*PTGTETNPPK Cobl-like 1 isoform 2 S827   -0.29 -0.61    
NP_057915 Coil VTGS*PAEEDEEETK coilin S174       0.15  
NP_031761 Col4a4 GDMVIS*RVKGQK procollagen, type IV, alpha 4 S554          
NP_001104532 Comt1 AVYQGPGSS*PVK catechol-O-methyltransferase S261     -0.01    
NP_001104532 Comt1 AVYQGPGSS*PVKS catechol-O-methyltransferase S261   0.39 -0.33 0.04  
NP_080728 Coq9 YTDQS*GEEEEDYESEEQLQHR coenzyme Q9 homolog S81       -0.46  
NP_444301 Cox6c MS*SGALLPKPQMR cytochrome c oxidase, subunit VIc S2          
NP_694806 Cpne5 GQSQFNIY*EVINPKKKMK copine V Y284          
NP_444423 Cpsf1 VY*AVAT*S*T*NTPCTRIPRMTGEEK cleavage and polyadenylation specific factor 1 Y1032, T1036, S1037, T1038          
NP_038527 Cr1l NS*LTQEVS complement receptor related protein S434          
NP_038527 Cr1l Y*KKRNTT*DEK complement receptor related protein Y388, T394          
NP_660133 Crebzf RKSPGAGGGGANDGNQAAT*K HCF-binding transcription factor Zhangfei T211       4.64  
NP_001004062 Crtc1 TNS*DSALHQSTMTPSQAESFTGGSQDAHQK CREB regulated transcription coactivator 1 S151       -1.37  
NP_083157 Crtc2 T*SSDSALHTSVMNPNPQDTYPGPTPPSVLPSR transducer of regulated cAMP response element-binding protein (CREB) 2 T169       -0.33  
NP_035863 Csda AGEAPTENPAPATEQSS*A cold shock domain protein A short isoform S290          
NP_035863 Csda AGEAPTENPAPATEQSS*AE cold shock domain protein A short isoform S290          
NP_035863 Csda RS*RPLNAVSQDGK cold shock domain protein A short isoform S259       1.05  
NP_035863 Csda S*PAASGAPQAPAPAALLAGSPGGDAAPGPAPASSAPAGGEDAEK cold shock domain protein A short isoform S33   0.14      
NP_035863 Csda S*PAASGAPQAPAPAALLAGSPGGDAAPGPAPASSAPAGGEDAEKK cold shock domain protein A short isoform S33       -0.29  
NP_035863 Csda S*RPLNAVSQDGK cold shock domain protein A short isoform S259   1.48 1.42 2.70 *
NP_035863 Csda S*RPLNAVSQDGKETK cold shock domain protein A short isoform S259       1.91  
NP_035863 Csda SRPLNAVS*QDGK cold shock domain protein A short isoform S266          
NP_444401 Csmd1 KVYDGKDS**SSR CUB and Sushi multiple domains 1 S1165          
NP_034103 Csn1s2b T*VMTEESKNIQDY*MNK casein alpha s2-like B T92, Y104       0.51  
NP_031817 Csrp1 GFGFGQGAGALVHS*E cysteine and glycine-rich protein 1 S192          
NP_663504 Cstf3 RPNEDS*DEDEEKGAVVPPVHDIYR cleavage stimulation factor subunit 3 isoform 1 S691   0.34   -0.65  
NP_666146 Ctage5 AFLS*PPTLLEGPLR CTAGE family, member 5 S512   0.33      
NP_001074856 Ctcfl T*QASEGEAGHK CCCTC-binding factor (zinc finger protein)-like T587          
NP_033948 Ctnna1 TPEELDDS*DFETEDFDVR catenin alpha 1 S641   0.21   -0.13  
NP_033948 Ctnna1 TPEELDDS*DFETEDFDVRS catenin alpha 1 S641          
NP_033948 Ctnna1 T*PEELDDSDFETEDFDVR catenin alpha 1 T634   -0.15      
NP_001103234 Ctnna2 S*RTS*VQTEDDQLIAGQSAR catenin (cadherin associated protein), alpha 2 isoform 2 S651, S654       -0.03  
NP_001103234 Ctnna2 S*RT*SVQT*EDDQLIAGQSAR catenin (cadherin associated protein), alpha 2 isoform 2 S651, T653, T657       -0.01  
NP_001103234 Ctnna2 SRTS*VQTEDDQLIAGQSAR catenin (cadherin associated protein), alpha 2 isoform 2 S654   0.22      
NP_001103234 Ctnna2 TS*VQTEDDQLIAGQSAR catenin (cadherin associated protein), alpha 2 isoform 2 S654   0.06      
NP_001103234 Ctnna2 SRTS*VQT*EDDQLIAGQSAR catenin (cadherin associated protein), alpha 2 isoform 2 S654, T657       0.04  
NP_001103234 Ctnna2 SRT*SVQTEDDQLIAGQSAR catenin (cadherin associated protein), alpha 2 isoform 2 T653   0.01      
NP_001103234 Ctnna2 T*SVQTEDDQLIAGQSAR catenin (cadherin associated protein), alpha 2 isoform 2 T653   0.12      
NP_001103234 Ctnna2 SRT*S*VQTEDDQLIAGQSAR catenin (cadherin associated protein), alpha 2 isoform 2 T653, S654       -0.03  
NP_001103234 Ctnna2 SRT*S*VQT*EDDQLIAGQSAR catenin (cadherin associated protein), alpha 2 isoform 2 T653, S654, T657       -0.39  
NP_001103234 Ctnna2 SRT*SVQT*EDDQLIAGQSAR catenin (cadherin associated protein), alpha 2 isoform 2 T653, T657       -0.03  
NP_061231 Ctnnal1 S*VEQTLLPLVSQITT*LINHK catenin (cadherin associated protein), alpha-like 1 S35, T49   3.71      
NP_031640 Ctnnb1 S*PQMVSAIVR catenin (cadherin associated protein), beta 1, 88kDa S191   0.35      
NP_031640 Ctnnb1 RTS*MGGTQQQFVEGVR catenin (cadherin associated protein), beta 1, 88kDa S552   1.50      
NP_031640 Ctnnb1 TS*MGGTQQQFVEGVR catenin (cadherin associated protein), beta 1, 88kDa S552   1.62 1.54 1.58 *
NP_031640 Ctnnb1 RT*SMGGTQQQFVEGVR catenin (cadherin associated protein), beta 1, 88kDa T551       1.72  
NP_031640 Ctnnb1 T*SMGGTQQQFVEGVR catenin (cadherin associated protein), beta 1, 88kDa T551   1.62 1.53 1.62 *
NP_031640 Ctnnb1 RTSMGGT*QQQFVEGVR catenin (cadherin associated protein), beta 1, 88kDa T556     1.77 1.74  
NP_001078917 Ctnnd1 HYEDGYPGGSDNYGS*LSR catenin, delta 1 isoform 2 S230   0.15   -0.98  
NP_001078917 Ctnnd1 HYEDGYPGGSDNYGSLS*R catenin, delta 1 isoform 2 S232       -0.95  
NP_001078917 Ctnnd1 APS*RQDVYGPQPQVR catenin, delta 1 isoform 2 S252     -0.43 -0.42  
NP_001078917 Ctnnd1 VGGS*SVDLHR catenin, delta 1 isoform 2 S268   0.37 0.31 -0.40  
NP_001078917 Ctnnd1 VGGS*S*VDLHR catenin, delta 1 isoform 2 S268, S269       -0.50  
NP_001078917 Ctnnd1 VGGSS*VDLHR catenin, delta 1 isoform 2 S269   0.41   0.17  
NP_001078917 Ctnnd1 S*MGYDDLDYGMMSDYGTAR catenin, delta 1 isoform 2 S288   0.30      
NP_001078917 Ctnnd1 GS*LAS*LDSLRK catenin, delta 1 isoform 2 S346, S349          
NP_001078917 Ctnnd1 GSLAS*LDSLR catenin, delta 1 isoform 2 S349   0.14      
NP_001078917 Ctnnd1 GSLAS*LDSLRK catenin, delta 1 isoform 2 S349   0.36      
NP_001078917 Ctnnd1 SDFQVNLNNAS*R catenin, delta 1 isoform 2 S857   3.04      
NP_001078917 Ctnnd1 SQSS*HSYDDSTLPLIDR catenin, delta 1 isoform 2 S862   1.51   0.66  
NP_001078917 Ctnnd1 SQSSHS*YDDSTLPLIDR catenin, delta 1 isoform 2 S864   1.54   0.76  
NP_001078917 Ctnnd1 S*GDLGDMEPLK catenin, delta 1 isoform 2 S899   -0.26 -0.19 -0.38 *
NP_001078917 Ctnnd1 TLDRS*GDLGDMEPLK catenin, delta 1 isoform 2 S899       -0.02  
NP_001078917 Ctnnd1 T*LDRSGDLGDMEPLK catenin, delta 1 isoform 2 T895       -0.28  
NP_001078917 Ctnnd1 TETT*VKKVVKTMTT*R catenin, delta 1 isoform 2 T140, T150          
NP_001078917 Ctnnd1 HYEDGYPGGSDNY*GSLSR catenin, delta 1 isoform 2 Y228       -1.04  
NP_001078917 Ctnnd1 SQSSHSY*DDSTLPLIDR catenin, delta 1 isoform 2 Y865       0.77  
NP_032755 Ctnnd2 SAS*APAS*PR catenin (cadherin associated protein), delta 2 S1093, S1097     43.72    
NP_033457 Ctr9 GEEGS*EEEETENGPKPK SH2 domain binding protein 1 (tetratricopeptide repeat containing) S970       -0.24  
NP_033457 Ctr9 GGEFDEFVNDDT*DDDLPVSK SH2 domain binding protein 1 (tetratricopeptide repeat containing) T925   -0.02      
NP_033457 Ctr9 KGGEFDEFVNDDT*DDDLPVSK SH2 domain binding protein 1 (tetratricopeptide repeat containing) T925   0.46   -0.21  
NP_033457 Ctr9 RPPKGEEGS*EEEETENGPKPK SH2 domain binding protein 1 (tetratricopeptide repeat containing) S970   0.16   -0.20  
NP_031829 Cttn HAS*QKDYSSGFGGKYGVQADR cortactin S150   6.54      
NP_031829 Cttn KQT*PPAS*PSPQPIEDRPPSS*PIYEDAAPFK cortactin T401, S405, S418       -0.81  
NP_031829 Cttn KQT*PPAS*PSPQPIEDRPPSSPIYEDAAPFK cortactin T401, S405       -0.04  
NP_031829 Cttn KQT*PPASPS*PQPIEDRPPSS*PIYEDAAPFK cortactin T401, S407, S418       -0.81  
NP_031829 Cttn KQT*PPASPS*PQPIEDRPPSSPIYEDAAPFK cortactin T401, S407   0.47   -0.04  
NP_031829 Cttn KQT*PPASPSPQPIEDRPPS*SPIYEDAAPFK cortactin T401, S417       -0.31  
NP_031829 Cttn KQT*PPASPSPQPIEDRPPSS*PIYEDAAPFK cortactin T401, S418   0.66   -0.19  
NP_031829 Cttn KQT*PPASPSPQPIEDRPPSSPIYEDAAPFK cortactin T401   1.31   -0.36  
NP_031829 Cttn KQTPPASPSPQPIEDRPPSS*PIYEDAAPFK cortactin S418       -0.29  
NP_031829 Cttn QTPPASPSPQPIEDRPPS*SPIYEDAAPFK cortactin S417       -0.41  
NP_031829 Cttn QTPPASPSPQPIEDRPPSS*PIYEDAAPFK cortactin S418       -0.41  
NP_031829 Cttn QTPPASPSPQPIEDRPPSSPIY*EDAAPFK cortactin Y421       -0.43  
NP_001156804 Cttnbp2nl DLS*PTLLDNSAAK CTTNBP2 N-terminal like S488     -0.78    
NP_001155090 Cul5 AYLDST*ER cullin 5 isoform 2 T285       <-10  
NP_034116 Cux1 AAS*REEPIEWEF cut-like homeobox 1 isoform a S1417   -1.16      
NP_001020363 Cxadr APQS*PTLAPAK coxsackievirus and adenovirus receptor isoform a S332   -1.10 -1.84 -1.98 *
NP_079834 Cyb5b RNS*AEETWMVIHGR cytochrome b5 type B precursor S33       0.30  
NP_031836 Cyp19a1 KGT*NIILNIGR cytochrome P450, family 19, subfamily a, polypeptide 1 T392     2.05    
NP_034125 Cyp21a1 LS*RS*ALMLGMR cytochrome P450, family 21, subfamily a, polypeptide 1 S120, S122          
NP_034140 Cyp46a1 QRKVMDLAFS*R cytochrome P450, family 46, subfamily a, polypeptide 1 S146          
NP_001025107 Cytsb LGS*SPTSSCNPTPTK cytospin B S52     -0.31    
NP_001025107 Cytsb LGSS*PTSSCNPTPTK cytospin B S53   0.12      
NP_613064 D11Wsu99e RS*PS*PAAMSER hypothetical protein LOC28081 S62, S64       -0.59  
NP_666071 D15Ertd621e YY*EELLK hypothetical protein LOC210998 Y64          
XP_001479168 D630015H07 MTTKGS*LPERK PREDICTED: hypothetical protein S42     11.48    
NP_080861 D6Wsu116e ARPAQAPVSEELPPS*PKPGK hypothetical protein LOC28006 S388       -0.86  
NP_080861 D6Wsu116e GLFS*DEEDSEDLFSSQSSSKPK hypothetical protein LOC28006 S533       0.05  
NP_080861 D6Wsu116e VPLLFS*DEEDSEVPSGVKPEDLK hypothetical protein LOC28006 S723   -0.12      
NP_080861 D6Wsu116e VS*PEVGSADVASIAQK hypothetical protein LOC28006 S747   0.05      
NP_780727 D730040F13Rik GGPAEAPS*PR hypothetical protein LOC242474 S12   0.81      
NP_666169 Dap DKDDQEWES*TSPPKPTVFISGVIAR death-associated protein S49       0.25  
NP_666169 Dap DKDDQEWEST*SPPKPTVFISGVIAR death-associated protein T50       -0.52  
NP_666169 Dap DKDDQEWESTS*PPKPTVF death-associated protein S51   -0.02 0.28 0.30  
NP_666169 Dap DKDDQEWESTS*PPKPTVFISGVIAR death-associated protein S51   0.90   0.25  
NP_666169 Dap DKDDQEWESTSPPKPT*VF death-associated protein T56          
NP_001033088 Dbi QAT*VGDVNTDRPGLLDLK diazepam binding inhibitor isoform 1 T84          
NP_062787 Dbn1 LSS*PVLHR drebrin 1 S142   0.02   0.29  
NP_001041692 Dbndd2 SPNPSDGGGDTPLAQS*DEEDGDDGGAEPGPCS SCF apoptosis response protein 1 S142          
NP_001041692 Dbndd2 TSS*LSSDSSNLR SCF apoptosis response protein 1 S117   -1.26      
NP_001139780 Dbnl LRS*PFLQK drebrin-like isoform 1 S291   -1.91   -1.55  
NP_001139780 Dbnl AMS*TTSVTSSQPGK drebrin-like isoform 1 S277   -0.66 -0.36 -0.11  
NP_001139780 Dbnl AMST*TSVTSSQPGK drebrin-like isoform 1 T278     -0.11 -0.14  
NP_001139780 Dbnl AMSTTS*VTSSQPGK drebrin-like isoform 1 S280          
NP_001139780 Dbnl QLT*QPETSYGR drebrin-like isoform 1 T299          
NP_001139780 Dbnl QLT*QPETSYGR drebrin-like isoform 1 T299       -0.01  
NP_113580 Dbr1 RLS*DEHEPEQR debranching enzyme homolog 1 S520       0.52  
NP_031858 Dck FCPS*PSTSSEGTR deoxycytidine kinase S11   0.12 0.20 0.54  
NP_031858 Dck FCPSPS*TSSEGTR deoxycytidine kinase S13   -0.21      
NP_081815 Dclk2 S*TKSSSSSPTSPGSFR doublecortin-like kinase 2 S333       9.69  
NP_081815 Dclk2 VLKSSYS*RAS*AAK doublecortin-like kinase 2 S295, S298          
NP_001103692 Dcx TSANMKAPQSLASS*NS*AQARENK doublecortin isoform a S165, S167       >10  
NP_084212 Ddx10 LASGDGDEEQDEET*EDEETEDHLGK DEAD (Asp-Glu-Ala-Asp) box polypeptide 10 T587       0.34  
NP_001035277 Ddx17 S*QPERDWVLNEFR DEAD box polypeptide 17 isoform 4 S374   1.34      
NP_001152974 Ddx24 LVKNPSRLFSS*EET*KK DEAD (Asp-Glu-Ala-Asp) box polypeptide 24 isoform 1 S114, T117          
NP_036138 Ddx3y QS*SGSANAGFNSNR DEAD (Asp-Glu-Ala-Asp) box polypeptide 3, Y-linked S603          
NP_082350 Ddx42 GGSRHS*HGDGGNR DEAD (Asp-Glu-Ala-Asp) box polypeptide 42 S821          
NP_081432 Ddx51 RVS*GSATPNSEAPR DEAD (Asp-Glu-Ala-Asp) box polypeptide 51 S77   -0.10   0.38  
NP_082317 Ddx54 IDDRDS*EEEGPSNQR DEAD (Asp-Glu-Ala-Asp) box polypeptide 54 S774       -0.01  
NP_001074684 Ddx60 RMIMIVYKS*LIQQLEKY*R DEAD (Asp-Glu-Ala-Asp) box polypeptide 60 S212, Y220          
NP_081461 Def6 QGY*LWKRGHLR differentially expressed in FDCP 6 Y222          
NP_080176 Dek EES*EEEEEDDEDDDEEDEEEEKEK DEK oncogene S33   0.30   -0.36  
NP_001074483 Dennd4c THS*FENVNCHLADSR DENN/MADD domain containing 4C S1145       -0.14  
NP_001020467 Dffa RS*PLPGEPQRPK DNA fragmentation factor, alpha subunit isoform a S314   -0.39      
NP_950176 Dgkq LGS*PAGS*PVLGISGR diacylglycerol kinase, theta S22, S26          
NP_945180 Dhx57 TEES*DFLLLVLK DEAH (Asp-Glu-Ala-Asp/His) box polypeptide 57 homolog S625       0.15  
NP_705758 Dis3l2 RPGLEKAS*DEEPED DIS3 mitotic control homolog (S. cerevisiae)-like 2 S864       0.12  
NP_001025478 Dkc1 VKVVEEMS*E dyskerin S508       0.16  
NP_001025478 Dkc1 VVEEMS*E dyskerin S508          
NP_031888 Dlg1 HVTSNAS*DSESSYR discs large homolog 1 S710   -0.09   -0.16  
NP_031888 Dlg1 DQSEQETSDADQHVTSNAS*DSESSYR discs large homolog 1 S710   -0.79      
NP_031888 Dlg1 EQMMNSSVSSGS*GSLR discs large homolog 1 S573       -0.70  
NP_031888 Dlg1 EQMMNSSVSSGSGS*LR discs large homolog 1 S575     -0.59 -0.52  
NP_001156985 Dlg5 ASQGSNS*LPSSAR discs large homolog 5 isoform 1 S1254       -0.21  
NP_001121653 Dlgap1 T*IQS*S*TGVIK discs large homolog-associated protein 1 isoform 4 T223, S226, S227          
XP_001478071 Dnahc6 EVLDPALEPILLKQTFMS*GGRLLIHLGDS*DIDY*DK PREDICTED: similar to SI:zC220F6.1 (novel protein similar to human dynein heavy chain (DHC)) S3071, S3082, Y3086          
NP_058055 Dnajc5 SLS*TSGESLYHVLGLDK DnaJ (Hsp40) homolog, subfamily C, member 5 S10   0.92      
NP_058055 Dnajc5 S*LSTSGESLYHVLGLDK DnaJ (Hsp40) homolog, subfamily C, member 5 S8   0.92   0.23  
NP_058055 Dnajc5 SLST*SGESLYHVLGLDK DnaJ (Hsp40) homolog, subfamily C, member 5 T11          
NP_001021118 Dnm1l SKPIPIMPAS*PQK dynamin 1-like isoform b S579   -0.43   -0.53  
NP_001033708 Dnm3 S*PPPS*PTTQR dynamin 3 isoform 1 S763, S767   -0.42      
NP_031898 Dnmt3a SEPQPEEGS*PAAGQK DNA methyltransferase 3A isoform 1 S102   -0.09   0.22  
NP_001003960 Dnmt3b DRGEDEES*R DNA methyltransferase 3B isoform 2 S401          
NP_598524 Dnttip1 QAEEESHRGS*PIPK terminal deoxynucleotidyltransferase interacting factor 1 S160       0.37  
NP_001028592 Dock1 KQTS*VDSGIVQ dedicator of cytokinesis 1 S1858   -0.56 -0.34 0.03  
NP_001028592 Dock1 KQT*SVDSGIVQ dedicator of cytokinesis 1 T1857     -0.32    
NP_001028592 Dock1 YDGT*TLR dedicator of cytokinesis 1 T542          
NP_083061 Dock8 VMS*SSNPDLTGSHCAADEEVK dedicator of cytokinesis 8 S903       0.02  
NP_083061 Dock8 VMSSS*NPDLTGSHCAADEEVK dedicator of cytokinesis 8 S905       0.00  
NP_081569 Dopey2 Y*KTSGNNPFFGK pad-1-like isoform 1 Y836          
NP_955354 Dot1l AAATEAPADS*GAEEEK DOT1-like, histone H3 methyltransferase S373       0.03  
NP_955354 Dot1l AERARS*TPS*PVPQPR DOT1-like, histone H3 methyltransferase S897, S900          
NP_955354 Dot1l AERARST*PS*PVPQPR DOT1-like, histone H3 methyltransferase T898, S900     #####    
NP_001028538 Dpcr1 QS*S*SPVYATETPRTSYNT*LK diffuse panbronchiolitis critical region 1 S210, S211, T226          
NP_079550 Dppa5a VPEDLKDPEVFQVQS*LVLKYLFGPQGSR developmental pluripotency associated 5A S31   -6.56      
NP_034085 Dpysl2 TS*PAKQQAPPVR dihydropyrimidinase-like 2 S522       0.95  
NP_034085 Dpysl2 GLYDGPVCEVSVT*PK dihydropyrimidinase-like 2 T509   -0.77      
NP_112451 Dscam ARSSMVSTESASS*TY*EELARAYEHAK Down syndrome cell adhesion molecule S1809, Y1811          
NP_076331 Dsp SMS*FQGIR desmoplakin S2221   -0.31      
NP_076331 Dsp AES*GPDLR desmoplakin S22   -0.92      
NP_076331 Dsp GLPSPYNMS*APGS*R desmoplakin S2832, S2836       -0.40  
NP_076331 Dsp S*SSLSDPLEESSPIAAIFDTENLEK desmoplakin S2618   -0.67      
NP_076331 Dsp SSSLS*DPLEESSPIAAIFDTENLEK desmoplakin S2622   -1.02      
NP_598594 Dst LVS*DT*IT*QK dystonin isoform a S3621, T3623, T3625          
NP_084042 Dtl TPS*SSPPVT*PPASETK denticleless homolog S509, T515   -0.23      
NP_034194 Dync1i2 EAEALLQSMGLTTDSPIVPPPMSPS*SK dynein cytoplasmic 1 intermediate chain 2 S83   -0.74      
NP_666341 Dync1li1 KPASVS*PTTPT*SPTEGEAS dynein cytoplasmic 1 light intermediate chain 1 S510, T515       -0.16  
NP_666341 Dync1li1 KPASVS*PTTPTS*PTEGEAS dynein cytoplasmic 1 light intermediate chain 1 S510, S516       -0.16  
NP_666341 Dync1li1 KPASVS*PTTPTSPTEGEAS dynein cytoplasmic 1 light intermediate chain 1 S510   0.02   -0.25  
NP_666341 Dync1li1 KPASVSPT*TPT*SPTEGEAS dynein cytoplasmic 1 light intermediate chain 1 T512, T515       0.10  
NP_666341 Dync1li1 KPASVSPTTPT*SPTEGEAS dynein cytoplasmic 1 light intermediate chain 1 T515   -0.39   -0.36  
NP_666341 Dync1li1 KPASVSPTTPTS*PTEGEAS dynein cytoplasmic 1 light intermediate chain 1 S516   -0.42   -0.36  
NP_001033046 Dyrk1b IYQY*IQSR dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 1b isoform b Y273   -0.17 0.06 0.08  
NP_001103487 Dzip3 EKIIVS*LNQQVAFGINKMS*K DAZ interacting protein 3, zinc finger isoform 1 S796, S809          
XP_001474905 E030010N08Rik EAETQKLEVT*NAELR PREDICTED: similar to ciliary rootlet coiled-coil, rootletin T546          
XP_982250 E030010N08Rik T*RLIQTEQET*LRK PREDICTED: similar to ciliary rootlet coiled-coil, rootletin T1605, T1614          
NP_001139393 E130112L23Rik IQQQLGEEAS*PR hypothetical protein LOC268739 isoform 2 S959   -0.13 -1.10 -14.44  
NP_001013395 E130306D19Rik WERKRVCT*AR hypothetical protein LOC230098 T26          
NP_848724 E2f7 MT*PKTPMK E2F transcription factor 7 T42          
NP_775562 E330016A19Rik KDISEAAET*VNK hypothetical protein LOC214763 T170          
NP_083208 Eaf1 TS*PLKDNPS*PEPQLDDIKR ELL associated factor 1 S158, S165       0.08  
NP_083208 Eaf1 T*SPLKDNPS*PEPQLDDIKR ELL associated factor 1 T157, S165       -0.20  
NP_062353 Ebag9 KLS*GDQITLPTTVDYSSVPK estrogen receptor-binding fragment-associated gene 9 S36   0.55   -0.18  
NP_853625 Edc4 TRS*PDVISSASTALSQDIPEIASEALSR cDNA sequence BC022641 S733   0.52      
NP_853625 Edc4 T*RSPDVISSASTALSQDIPEIASEALSR cDNA sequence BC022641 T731   0.55      
NP_853625 Edc4 DSQDT*SAEQSDHDDEVASLASASGGFGSK cDNA sequence BC022641 T863   -0.06   -0.33  
NP_853625 Edc4 DSQDTS*AEQSDHDDEVASLASASGGFGSK cDNA sequence BC022641 S864   0.04   0.01  
NP_853625 Edc4 DSQDTSAEQS*DHDDEVASLASASGGFGSK cDNA sequence BC022641 S868   0.23   -0.33  
NP_061266 Eef1b2 DDDDIDLFGS*DDEEESEEAKK eukaryotic translation elongation factor 1 beta 2 S106       -0.01  
NP_061266 Eef1b2 YGPSSVEDTTGSGAADAKDDDDIDLFGS*DDEEESEEAK eukaryotic translation elongation factor 1 beta 2 S106   -0.17      
NP_061266 Eef1b2 YGPSSVEDTTGSGAADAKDDDDIDLFGS*DDEEESEEAKK eukaryotic translation elongation factor 1 beta 2 S106   0.76   -0.54  
NP_075729 Eef1d ATAPQTQHVS*PMR eukaryotic translation elongation factor 1 delta isoform b S133   -0.14 -0.21 -0.01  
NP_075729 Eef1d ATAPQT*QHVSPMR eukaryotic translation elongation factor 1 delta isoform b T129     -0.24    
NP_075729 Eef1d GATPAEDDEDKDIDLFGS*DEEEEDKEAAR eukaryotic translation elongation factor 1 delta isoform b S162   0.50 -0.43 -0.49  
NP_075729 Eef1d KGATPAEDDEDKDIDLFGS*DEEEEDKEAAR eukaryotic translation elongation factor 1 delta isoform b S162   0.81   -0.40  
NP_080270 Efhd2 ADLNQGIGEPQS*PSR EF hand domain containing 2 S74   -1.86      
NP_080270 Efhd2 RADLNQGIGEPQS*PSR EF hand domain containing 2 S74       -0.82  
XP_136331 EG240921 S*FPAMS*LS*PATPPKKPR PREDICTED: hypothetical protein S457, S462, S464          
XP_284106 EG330129 ET*GWKPS*R PREDICTED: similar to P300/CBP-associated factor T706, S711          
XP_484844 EG433283 T*RT*LLVGER PREDICTED: hypothetical protein isoform 1 T148, T150          
XP_001487831 EG545741 GAAQNIIPAS*T*GTAK PREDICTED: similar to glyceraldehyde-3-phosphate-dehydrogenase isoform 1 S210, T211          
XP_001487831 EG545741 GAAQNIIPAST*GT*AK PREDICTED: similar to glyceraldehyde-3-phosphate-dehydrogenase isoform 1 T211, T213          
XP_621046 EG546337 SRSRSFSSPSPS*PTPSPHRPPVRTK PREDICTED: similar to conserved nuclear protein Nhn1 isoform 1 S613          
XP_621074 EG546362 LLAEPVPGIKAEPDES*KAR PREDICTED: similar to ubiquitin-conjugating enzyme E2 UbcH-ben S30          
XP_894897 EG622236 NIDDGT*LDRPYS*HALVAGIDR PREDICTED: hypothetical protein isoform 1 T33, S39          
XP_902195 EG622446 MS*DAAVDT*NSEITTK PREDICTED: hypothetical protein S2, T8          
XP_896668 EG626952 AVIPS*GAHPVGRALEASRNPS*K PREDICTED: similar to Lage3 protein S35, S51          
XP_920080 EG638833 AS*NAS*CTTNCLAPLAK PREDICTED: hypothetical protein S164, S167          
XP_920080 EG638833 AS*NAS*CTTNCLAPLAK PREDICTED: hypothetical protein S164, S167          
XP_920080 EG638833 AS*NAS*CTTNCLAPLAK PREDICTED: hypothetical protein S164, S167          
XP_920080 EG638833 VIISAPS*ADTPMFVMGVNQKK PREDICTED: hypothetical protein S141          
XP_001480324 EG640530 HT*NSVPHGR PREDICTED: similar to Murinoglobulin 1 T646       >10  
XP_922860 EG640703 SRVS*NPAPRR PREDICTED: similar to calmodulin S59          
XP_001478598 EG665669 S*VWPS*SIGQVPAYGQK PREDICTED: similar to EG635895 protein S470, S474     0.10    
XP_001000540 EG666747 ERRTT*LWWLK PREDICTED: hypothetical protein isoform 2 T165          
XP_001002180 EG668548 HTGPGILSMANAGPNTNS*S*QFFICTAK PREDICTED: hypothetical protein S109, S110          
NP_758469 Eif2b5 AGS*PQLDDIR eukaryotic translation initiation factor 2B, subunit 5 epsilon S540   -0.26 0.05 0.10  
NP_034253 Eif3a AREES*WGPPR eukaryotic translation initiation factor 3, subunit 10 (theta) S1149          
NP_598677 Eif3b AKPAAQS*EEETAT*SPAAS*PTPQSAER eukaryotic translation initiation factor 3, subunit 9 S68, T74, S79          
NP_598677 Eif3b AKPAAQS*EEETATS*PAAS*PTPQSAER eukaryotic translation initiation factor 3, subunit 9 S68, S75, S79       -0.10  
NP_598677 Eif3b AKPAAQS*EEETATS*PAASPT*PQSAER eukaryotic translation initiation factor 3, subunit 9 S68, S75, T81       -0.09  
NP_598677 Eif3b AKPAAQS*EEETATS*PAASPTPQSAER eukaryotic translation initiation factor 3, subunit 9 S68, S75   0.76   -0.24  
NP_598677 Eif3b AKPAAQS*EEETATSPAAS*PTPQSAER eukaryotic translation initiation factor 3, subunit 9 S68, S79       -0.19  
NP_598677 Eif3b AKPAAQSEEET*ATS*PAAS*PTPQSAER eukaryotic translation initiation factor 3, subunit 9 T72, S75, S79          
NP_598677 Eif3b AKPAAQSEEET*ATS*PAASPTPQSAER eukaryotic translation initiation factor 3, subunit 9 T72, S75   -0.16      
NP_598677 Eif3b AKPAAQSEEETAT*S*PAAS*PTPQSAER eukaryotic translation initiation factor 3, subunit 9 T74, S75, S79       -0.36  
NP_598677 Eif3b AKPAAQSEEETAT*SPAAS*PTPQSAER eukaryotic translation initiation factor 3, subunit 9 T74, S79       0.03  
NP_598677 Eif3b AKPAAQSEEETATS*PAAS*PTPQSAER eukaryotic translation initiation factor 3, subunit 9 S75, S79   0.32 -0.18 -0.31  
NP_598677 Eif3b AKPAAQSEEETATS*PAASPT*PQSAER eukaryotic translation initiation factor 3, subunit 9 S75, T81   0.17   0.56  
NP_598677 Eif3b AKPAAQSEEETATS*PAASPTPQSAER eukaryotic translation initiation factor 3, subunit 9 S75   0.15   -0.28  
NP_598677 Eif3b GHPSAGAEEEGGS*DGS*AAEAEPR eukaryotic translation initiation factor 3, subunit 9 S120, S123       0.36  
NP_598677 Eif3b GHPSAGAEEEGGS*DGSAAEAEPR eukaryotic translation initiation factor 3, subunit 9 S120          
NP_598677 Eif3b GHPSAGAEEEGGS*DGSAAEAEPR eukaryotic translation initiation factor 3, subunit 9 S120   -0.25   0.25  
NP_598677 Eif3b GHPSAGAEEEGGSDGS*AAEAEPR eukaryotic translation initiation factor 3, subunit 9 S123          
NP_598677 Eif3b S*PSQEPSAPGK eukaryotic translation initiation factor 3, subunit 9 S88   0.59      
NP_598677 Eif3b SPS*QEPSAPGK eukaryotic translation initiation factor 3, subunit 9 S90   0.62      
NP_666312 Eif3c QPLLLS*EDEEDTKR eukaryotic translation initiation factor 3, subunit C S39       -0.05  
NP_058572 Eif3g GIPLPT*GDTSPEPELLPGDPLPPPK eukaryotic translation initiation factor 3, subunit G T38   0.17      
NP_058572 Eif3g GIPLPTGDT*SPEPELLPGDPLPPPK eukaryotic translation initiation factor 3, subunit G T41   -0.02      
NP_058572 Eif3g GIPLPTGDTS*PEPELLPGDPLPPPK eukaryotic translation initiation factor 3, subunit G S42   0.17   -0.27  
NP_660121 Eif3l NFIQY*FHK eukaryotic translation initiation factor 3 subunit 6 interacting protein Y58          
NP_663600 Eif4b AFGS*GYR eukaryotic translation initiation factor 4B S283   -2.38   -0.01  
NP_663600 Eif4b EEDCHS*PTSKPPKPDQPLK eukaryotic translation initiation factor 4B S459   -0.19      
NP_663600 Eif4b SLENETLNKEEDCHS*PTSKPPKPDQPLK eukaryotic translation initiation factor 4B S459       -1.22  
NP_663600 Eif4b SLENETLNKEEDCHSPT*SKPPKPDQPLK eukaryotic translation initiation factor 4B T461   -0.28   -1.33  
NP_663600 Eif4b ARPT*TDSFDDYPPR eukaryotic translation initiation factor 4B T204       0.20  
NP_663600 Eif4b ARPTT*DSFDDYPPR eukaryotic translation initiation factor 4B T205       0.21  
NP_663600 Eif4b ARPTTDS*FDDYPPR eukaryotic translation initiation factor 4B S207       0.05  
NP_663600 Eif4b S*QSSDTEQPSPTSGGGK eukaryotic translation initiation factor 4B S495   -1.00      
NP_663600 Eif4b SQS*SDTEQPSPTSGGGK eukaryotic translation initiation factor 4B S497   -0.47      
NP_663600 Eif4b SQSS*DTEQPSPTSGGGK eukaryotic translation initiation factor 4B S498   -0.47      
NP_663600 Eif4b SQSSDTEQPS*PTSGGGK eukaryotic translation initiation factor 4B S504   0.31      
NP_663600 Eif4b T*GSESS*QTGASATSGR eukaryotic translation initiation factor 4B T420, S425   1.20      
NP_663600 Eif4b T*GSESSQTGASATSGR eukaryotic translation initiation factor 4B T420   0.01      
NP_663600 Eif4b TGS*ESS*QTGASATSGR eukaryotic translation initiation factor 4B S422, S425   1.22      
NP_663600 Eif4b TGS*ESSQTGASATSGR eukaryotic translation initiation factor 4B S422   0.01      
NP_663600 Eif4b YAALS*VDGEDEDEGDDCTE eukaryotic translation initiation factor 4B S597          
NP_031944 Eif4ebp1 T*PPKDLPAIPGVTSPTSDEPPMQASQSQLPS*SPEDKR eukaryotic translation initiation factor 4E binding protein 1 T69, S99       0.30  
NP_031944 Eif4ebp1 T*PPKDLPAIPGVTSPTSDEPPMQASQSQLPSSPEDK eukaryotic translation initiation factor 4E binding protein 1 T69   0.59      
NP_031944 Eif4ebp1 T*PPKDLPAIPGVTSPTSDEPPMQASQSQLPSSPEDKR eukaryotic translation initiation factor 4E binding protein 1 T69   0.94      
NP_031944 Eif4ebp1 TPPKDLPAIPGVTSPTS*DEPPMQASQSQLPSSPEDKR eukaryotic translation initiation factor 4E binding protein 1 S85   0.19      
NP_031944 Eif4ebp1 VALGDGVQLPPGDYST*TPGGTLFSTT*PGGTR eukaryotic translation initiation factor 4E binding protein 1 T35, T45   -0.08      
NP_031944 Eif4ebp1 VALGDGVQLPPGDYSTT*PGGTLFS*TTPGGTR eukaryotic translation initiation factor 4E binding protein 1 T36, S43   0.34      
NP_031944 Eif4ebp1 VALGDGVQLPPGDYSTT*PGGTLFSTT*PGGTR eukaryotic translation initiation factor 4E binding protein 1 T36, T45   0.15      
NP_031944 Eif4ebp1 VALGDGVQLPPGDYSTT*PGGTLFSTTPGGT*R eukaryotic translation initiation factor 4E binding protein 1 T36, T49   0.20      
NP_031944 Eif4ebp1 VALGDGVQLPPGDYSTTPGGT*LFSTT*PGGTR eukaryotic translation initiation factor 4E binding protein 1 T40, T45   0.87      
NP_031944 Eif4ebp1 VALGDGVQLPPGDYSTTPGGT*LFSTTPGGT*R eukaryotic translation initiation factor 4E binding protein 1 T40, T49       -0.17  
NP_031944 Eif4ebp1 VALGDGVQLPPGDYSTTPGGTLFS*TT*PGGTR eukaryotic translation initiation factor 4E binding protein 1 S43, T45   0.36      
NP_034254 Eif4ebp2 NSPMAQT*PPCHLPNIPGVTSPGALIEDSK eukaryotic translation initiation factor 4E binding protein 2 T70   1.47      
NP_034254 Eif4ebp2 RNS*PMAQTPPCHLPNIPGVTSPGALIEDSK eukaryotic translation initiation factor 4E binding protein 2 S65   0.59      
NP_034254 Eif4ebp2 TVAISDAAQLPQDYCT*TPGGTLFSTT*PGGTR eukaryotic translation initiation factor 4E binding protein 2 T36, T46   0.90      
NP_034254 Eif4ebp2 TVAISDAAQLPQDYCTT*PGGTLFS*TTPGGTR eukaryotic translation initiation factor 4E binding protein 2 T37, S44     0.12    
NP_034254 Eif4ebp2 TVAISDAAQLPQDYCTT*PGGTLFSTT*PGGTR eukaryotic translation initiation factor 4E binding protein 2 T37, T46   0.87 -0.08 -0.16  
NP_034254 Eif4ebp2 TVAISDAAQLPQDYCTT*PGGTLFSTTPGGT*R eukaryotic translation initiation factor 4E binding protein 2 T37, T50       0.16  
NP_034254 Eif4ebp2 TVAISDAAQLPQDYCTTPGGT*LFSTT*PGGTR eukaryotic translation initiation factor 4E binding protein 2 T41, T46   0.40      
NP_034254 Eif4ebp2 TVAISDAAQLPQDYCTTPGGTLFS*TT*PGGTR eukaryotic translation initiation factor 4E binding protein 2 S44, T46     0.03    
NP_001005331 Eif4g1 S*FSKEVEER eukaryotic translation initiation factor 4, gamma 1 isoform b S1180       -0.52  
NP_001005331 Eif4g1 RSFS*KEVEER eukaryotic translation initiation factor 4, gamma 1 isoform b S1182          
NP_001005331 Eif4g1 SFS*KEVEER eukaryotic translation initiation factor 4, gamma 1 isoform b S1182   -0.12   0.27  
NP_001005331 Eif4g1 S*RERPSQPEGLR eukaryotic translation initiation factor 4, gamma 1 isoform b S1189          
NP_001005331 Eif4g1 EATLPPVS*PPK eukaryotic translation initiation factor 4, gamma 1 isoform b S1224   0.04 0.06 -0.10  
NP_001035221 Eif4g2 TQT*PPLGQTPQLGLK eukaryotic translation initiation factor 4, gamma 2 isoform 2 T469   -1.34      
NP_766291 Eif4g3 TSS*PTSLPPLAR eukaryotic translation initiation factor 4 gamma, 3 S285     -0.13    
NP_938045 Eif5b SVPTVDS*GNEDDDSSFK eukaryotic translation initiation factor 5B S215   0.03 -0.06 -0.10  
NP_938045 Eif5b TARPNSEAPLS*GS*EDADDSNK eukaryotic translation initiation factor 5B S137, S139       -0.18  
NP_938045 Eif5b TARPNSEAPLS*GSEDADDSNK eukaryotic translation initiation factor 5B S137   0.37   0.00  
NP_938045 Eif5b TARPNSEAPLS*GSEDADDSNKLSK eukaryotic translation initiation factor 5B S137       -0.20  
NP_938045 Eif5b TARPNSEAPLSGS*EDADDSNK eukaryotic translation initiation factor 5B S139   0.29   0.00  
NP_938045 Eif5b TARPNSEAPLSGS*EDADDSNKLSK eukaryotic translation initiation factor 5B S139          
NP_938045 Eif5b TSFDENDS*EELEDKDSK eukaryotic translation initiation factor 5B S114       -0.18  
NP_031946 Elf1 TKPPRPDS*PTTTPNISVK E74-like factor 1 S187   -0.51   -0.06  
NP_031950 Ell ARQS*MAQAEEETRSR elongation factor RNA polymerase II S133       14.27  
NP_031950 Ell LCQPQNATTDSS*PPR elongation factor RNA polymerase II S300   0.38      
NP_038564 Emg1 RFS*VQEQDWETTPPKK EMG1 nucleolar protein homolog S16       0.73  
NP_659121 Eml3 AAS*SANLLLR echinoderm microtubule associated protein like 3 S177     4.82    
NP_659121 Eml3 KAAS*SANLLLR echinoderm microtubule associated protein like 3 S177       0.56  
NP_001076589 Enah GST*IETEQKEDRNEDAEPITAK enabled homolog isoform 3 T679       -0.47  
NP_059496 Enam WGDEEMNFKGNPT*VRQYEGEHYAS*TLAK enamelin T820, S831          
NP_059496 Enam WGDEEMNFKGNPT*VRQYEGEHYAST*LAK enamelin T820, T832          
NP_001021383 Ensa YFDS*GDYNMAK endosulfine alpha isoform b S67   -2.08 -0.43 -0.62  
NP_808489 Ep300 TDGKEEEEQPSTSATQS*SPAPGQSK E1A binding protein p300 S1036   0.53      
NP_808489 Ep300 TDGKEEEEQPSTSATQSS*PAPGQSK E1A binding protein p300 S1037   0.53   -0.11  
NP_001122078 Epb4.1 RLS*THSPFR erythrocyte protein band 4.1 isoform 2 S649       -0.31  
NP_001122078 Epb4.1 SLDGAAAAESTDRS*PRPTSAPAIAQSQVTEGPGAPIKK erythrocyte protein band 4.1 isoform 2 S556       -1.80  
NP_001006665 Epb4.1l1 SLDGAEFSRPAS*VSENHDAGPDGDKR erythrocyte protein band 4.1-like 1 isoform a S441       -0.65  
NP_001003815 Epb4.1l1 APES*DTGDEDQDQER erythrocyte protein band 4.1-like 1 isoform b S565       -0.14  
NP_001003815 Epb4.1l1 DKS*DSETEGLVFAR erythrocyte protein band 4.1-like 1 isoform b S635   0.91   -0.34  
NP_001003815 Epb4.1l1 GACST*PEMPQFESVK erythrocyte protein band 4.1-like 1 isoform b T672   -0.69 -0.61 -0.66 *
NP_001003815 Epb4.1l1 HQAS*INELKR erythrocyte protein band 4.1-like 1 isoform b S497          
NP_001003815 Epb4.1l1 LPSSPAS*PSPK erythrocyte protein band 4.1-like 1 isoform b S531   -4.85      
NP_001003815 Epb4.1l1 RLPS*SPAS*PSPK erythrocyte protein band 4.1-like 1 isoform b S527, S531       -4.35  
NP_001003815 Epb4.1l1 RLPS*SPASPS*PK erythrocyte protein band 4.1-like 1 isoform b S527, S533       -3.81  
NP_001003815 Epb4.1l1 RLPSS*PAS*PSPK erythrocyte protein band 4.1-like 1 isoform b S528, S531       -3.81  
NP_001003815 Epb4.1l1 RLPSS*PASPS*PK erythrocyte protein band 4.1-like 1 isoform b S528, S533          
NP_001003815 Epb4.1l1 RLPSS*PASPSPK erythrocyte protein band 4.1-like 1 isoform b S528       -2.66  
NP_001003815 Epb4.1l1 RLPSSPAS*PSPK erythrocyte protein band 4.1-like 1 isoform b S531   -2.62 -1.99 -2.64 *
NP_001003815 Epb4.1l1 RLPSSPASPS*PK erythrocyte protein band 4.1-like 1 isoform b S533   -3.53 -2.66 -4.53 *
NP_001003815 Epb4.1l1 RSEAEEGEVRT*PTK erythrocyte protein band 4.1-like 1 isoform b T474       -0.32  
NP_001003815 Epb4.1l1 RSEAEEGEVRTPT*K erythrocyte protein band 4.1-like 1 isoform b T476       -0.32  
NP_001003815 Epb4.1l1 SEAEEGEVRT*PTK erythrocyte protein band 4.1-like 1 isoform b T474       -1.60  
NP_001003815 Epb4.1l1 SLPELDRDKS*DSETEGLVFAR erythrocyte protein band 4.1-like 1 isoform b S635       0.06  
NP_001003815 Epb4.1l1 SLS*PIIGK erythrocyte protein band 4.1-like 1 isoform b S769   -0.43 -0.70 -0.96 *
NP_038539 Epb4.1l2 AKEVENEQTPVS*EPEEEKGSQPGPPVER erythrocyte protein band 4.1-like 2 S38       -0.24  
NP_038539 Epb4.1l2 EVENEQTPVS*EPEEEKGSQPGPPVER erythrocyte protein band 4.1-like 2 S38   -0.18      
NP_038539 Epb4.1l2 VTPLPFQPQASS*HETLNVVEEK erythrocyte protein band 4.1-like 2 S666   -0.21      
NP_038841 Epb4.1l3 RAS*ALIDRPAPYFER erythrocyte protein band 4.1-like 3 S428          
NP_766251 Epc2 Y*KHCLTTLTVPR enhancer of polycomb homolog 2 Y434          
NP_034269 Epha2 VS*IRLPS*TSGSEGVPFR ephrin receptor EphA2 S893, S898          
NP_775623 Ephb1 KRAYSKEAAY*SDK Eph receptor B1 Y575          
NP_034278 Epn2 AGGS*PASYHGSTSPR epsin 2 S192          
NP_034278 Epn2 GS*SQPNLSTSYSEQEYGK epsin 2 S172       -0.03  
NP_034278 Epn2 GSS*QPNLSTSYSEQEYGK epsin 2 S173     -0.34    
NP_082260 Epn3 GDDS*PVANGAEPAGQR epsin 3 S257   -0.35   -0.11  
NP_082260 Epn3 GSPSSYTSASSS*PR epsin 3 S185       -0.78  
NP_082260 Epn3 SRGSPS*SYTSASSSPR epsin 3 S177   0.31      
NP_082260 Epn3 SRGSPSS*YTSASSSPR epsin 3 S178   -0.32      
NP_082260 Epn3 SRGSPSSY*TSASSSPR epsin 3 Y179       -0.33  
NP_082260 Epn3 SWKGDDS*PVANGAEPAGQR epsin 3 S257       -0.56  
NP_082260 Epn3 TPVLPSGPPIADPWAPS*SPTR epsin 3 S386   -0.23   -0.56  
NP_082260 Epn3 TPVLPSGPPIADPWAPSS*PTR epsin 3 S387   -0.23   -0.58  
NP_082260 Epn3 TPVLPSGPPIADPWAPSSPT*R epsin 3 T389   -0.28      
NP_659097 Eppk1 QVS*ASELCTSGILDR epiplakin 1 S2705   -1.07      
NP_031969 Eps15 FHDS*SSPLLTSGPSVAELPWAVK epidermal growth factor receptor pathway substrate 15 isoform A S106   0.04      
NP_031969 Eps15 FHDSSS*PLLTSGPSVAELPWAVK epidermal growth factor receptor pathway substrate 15 isoform A S108   0.05      
NP_001153436 Eps15 VGT*PTRPCPPPPGK epidermal growth factor receptor pathway substrate 15 isoform B T465   -1.95      
NP_080422 Eps8l1 GASPAAET*PPLQR epidermal growth factor receptor pathway substrate 8-like protein 1 T187   -3.68 -0.89 -1.50  
NP_080422 Eps8l1 RGAS*PAAET*PPLQR epidermal growth factor receptor pathway substrate 8-like protein 1 S182, T187       -2.47  
NP_573454 Eps8l2 YWGPAS*PTHK epidermal growth factor receptor pathway substrate 8-like protein 2 S573   -1.58   -0.46  
NP_573454 Eps8l2 YWGPASPT*HK epidermal growth factor receptor pathway substrate 8-like protein 2 T575   -1.58   -0.42  
NP_573454 Eps8l2 HSLSSESQAPEDIAPPGS*SPHANR epidermal growth factor receptor pathway substrate 8-like protein 2 S482       -1.39  
NP_573454 Eps8l2 HSLSSESQAPEDIAPPGSS*PHANR epidermal growth factor receptor pathway substrate 8-like protein 2 S483   -0.38   -1.28  
NP_083771 Epsti1 LQKT*RDGHQKNK epithelial stromal interaction 1 isoform a T248          
NP_001005868 Erbb2ip S*TEDLSPQR Erbb2 interacting protein isoform 1 S849   0.75      
NP_789808 Esrp2 SGLS*PPPCK epithelial splicing regulatory protein 2 S563   -0.42      
NP_036065 Esrrg KY*KS*MKLEK estrogen-related receptor gamma Y356, S358          
NP_001074475 Etl4 IGGKS*PPPPPPPPR enhancer trap locus 4 S1100          
NP_001074475 Etl4 SSSLPSASGDSSNLPNAPATKPSIASTPLS*PQAGR enhancer trap locus 4 S1894   -1.39      
NP_001074475 Etl4 TRAS*LPVVR enhancer trap locus 4 S220   -0.09   -0.26  
NP_031987 Etv6 ISY*TPPES*PVASHR ets variant 6 Y17, S22       0.14  
NP_031987 Etv6 ISYT*PPES*PVASHR ets variant 6 T18, S22       0.10  
NP_031987 Etv6 LQQENNHQETYPLSVS*PVENNHCLPSSPWQESTR ets variant 6 S240   0.14      
NP_031987 Etv6 SST*PLHVHTVPR ets variant 6 T31       0.72  
NP_031989 Evi1 MEPQS*PSEVKK ecotropic viral integration site 1 S528   -0.50      
NP_031989 Evi1 NFIGNS*NHGSQSPR ecotropic viral integration site 1 S835       0.42  
NP_031989 Evi1 NFIGNSNHGSQS*PR ecotropic viral integration site 1 S841   0.59 -0.56 0.01  
NP_001028883 Evi2a S*KQVGKRQPR ecotropic viral integration site 2A S160          
NP_079552 Evpl AAS*PTLPR envoplakin S2026   -0.50 0.15 -0.04  
NP_766235 F11r VIYSQPS*TR F11 receptor S285   0.46 0.10 -0.33  
XP_001003844 F420015M19Rik LAKSVEKT*K PREDICTED: similar to putative retrovirus-related gag protein T140          
NP_032002 F5 MPMGLS*T*GVISDSQIK coagulation factor V S1873, T1874   -0.07      
NP_001032814 Fam117b T*SPTVATQTGASVTSTR family with sequence similarity 117, member B isoform a T101   -0.34      
NP_001032814 Fam117b TS*PTVATQTGASVTSTR family with sequence similarity 117, member B isoform a S102   -0.34      
NP_080796 Fam122a RIDFIPVSPAPS*PTR hypothetical protein LOC68034 S144          
NP_080796 Fam122a RNS*TTFPSR hypothetical protein LOC68034 S59       1.01  
NP_080796 Fam122a HGLLLPAS*PVR hypothetical protein LOC68034 S73   0.20   -0.12  
NP_080796 Fam122a RNST*TFPSR hypothetical protein LOC68034 T60       1.02  
NP_080796 Fam122a SNS*APLIHGLSDSSPVFQAEAPSAR hypothetical protein LOC68034 S34   0.10      
NP_082893 Fam125a GLS*LDPPKEPSK family with sequence similarity 125, member A S168       -0.04  
NP_071301 Fam129a HNLFEDNMALPSESVS*SLTDLK family with sequence similarity 129, member A S580   0.38      
NP_071301 Fam129a HNLFEDNMALPSESVSS*LTDLK family with sequence similarity 129, member A S581   0.60      
NP_071301 Fam129a IHPEASHPAAIQQDS*CEER family with sequence similarity 129, member A S755   -0.05   -0.27  
NP_071301 Fam129a RVS*AILPGAPDNELPSNEVFQEPEEK family with sequence similarity 129, member A S601   1.26   0.36  
NP_071301 Fam129a TAMGSNQAS*PAR family with sequence similarity 129, member A S595   -0.86      
NP_080880 Fam135a SAVPDCHLSDS*KTVFNLGT*MDLPKCDDTK hypothetical protein LOC68187 S868, T876          
NP_796061 Fam179a S*PAS*KPLVPVVKAK hypothetical protein LOC320159 S292, S295          
NP_705791 Fam40a AAS*PPASASDLIEQQQK hypothetical protein LOC229707 S335   0.03      
NP_084035 Fam54b NAS*VPNLR hypothetical protein LOC76824 S100     0.16 -0.14  
NP_084035 Fam54b AS*FETLPNISDLCLK hypothetical protein LOC76824 S38   4.36      
NP_084035 Fam54b ASS*FADMMGILK hypothetical protein LOC76824 S235   0.63   -0.47  
NP_789806 Fam76b SSLS*PEQEQGLWK hypothetical protein LOC72826 S193       0.12  
NP_789806 Fam76b VSS*LSPEQEQGLWK hypothetical protein LOC72826 S191       0.23  
NP_789806 Fam76b VSSLS*PEQEQGLWK hypothetical protein LOC72826 S193   -0.59   0.17  
NP_001028308 Fam82a2 S*HSLPNSLDYAQASER family with sequence similarity 82, member A2 S44   0.88   1.55  
NP_001028308 Fam82a2 SHS*LPNSLDYAQASER family with sequence similarity 82, member A2 S46       1.40  
NP_666098 Fam83f IGLNY*SSTVARKLINPK hypothetical protein LOC213956 Y308          
NP_598848 Fam83h RGS*PVPPVPER family with sequence similarity 83, member H S948   -0.38 -0.17 -0.16  
NP_598848 Fam83h RGS*PVPPVPERR family with sequence similarity 83, member H S948       0.87  
NP_598848 Fam83h GSPT*STYPDR family with sequence similarity 83, member H T939          
NP_598848 Fam83h HGS*DPAFGPSPR family with sequence similarity 83, member H S522   -1.13 -0.96 -0.54 *
NP_598848 Fam83h KGS*PTPAYPER family with sequence similarity 83, member H S882   0.28 -0.06 -0.18  
NP_598848 Fam83h KGS*PTPAYPERK family with sequence similarity 83, member H S882       -0.18  
NP_598848 Fam83h KGS*PTQAYPER family with sequence similarity 83, member H S904   0.17   0.17  
NP_598848 Fam83h KGS*PTSGFPNR family with sequence similarity 83, member H S915   -0.24 -0.10 -0.11  
NP_598848 Fam83h KGSPT*PAYPER family with sequence similarity 83, member H T884   -0.07 -0.09 -0.28  
NP_598848 Fam83h KGSPT*QAYPER family with sequence similarity 83, member H T906       -0.10  
NP_598848 Fam83h KGSPT*SGFPNR family with sequence similarity 83, member H T917       -0.09  
NP_598848 Fam83h RGS*LTFAGESSK family with sequence similarity 83, member H S970   0.50 0.65 0.59 *
NP_598848 Fam83h RGS*PTTGLMEQK family with sequence similarity 83, member H S926   0.31 -0.03 0.11  
NP_598848 Fam83h RGSLT*FAGESSK family with sequence similarity 83, member H T972     0.46 2.00  
NP_598848 Fam83h RGSPT*TGLMEQK family with sequence similarity 83, member H T928       0.19  
NP_598848 Fam83h RGSPTT*GLMEQK family with sequence similarity 83, member H T929          
NP_058621 Fanca EQKLKDS*ALKLLR Fanconi anemia, complementation group A S46       5.07  
NP_598843 Farp1 LGAPENSGIS*TLER FERMRhoGEF (Arhgef) and pleckstrin domain protein 1 S23     0.25    
NP_598843 Farp1 LGAPENSGIST*LER FERMRhoGEF (Arhgef) and pleckstrin domain protein 1 T24   1.12 0.23 0.01  
NP_598843 Farp1 SPDEATAADQES*EDDLSAS*RTS*LER FERMRhoGEF (Arhgef) and pleckstrin domain protein 1 S892, S899, S902       -0.45  
NP_663494 Farp2 T*RTSLHALTVDLPK FERM, RhoGEF and pleckstrin domain protein 2 T372          
NP_663494 Farp2 TRTS*LHALTVDLPK FERM, RhoGEF and pleckstrin domain protein 2 S375       0.66  
NP_032017 Fbl RVS*ISEGDDKIEYR fibrillarin S130       0.33  
NP_598526 Fbxo31 QQRRGPAETAAADS*EADTDPEEER F-box protein 31 S33          
NP_081067 Fbxw9 KVT*IYDPR F-box and WD-40 domain protein 9 T289          
NP_608219 Fdps YKS*IVK farnesyl diphosphate synthase S195     8.83    
NP_032025 Fen1 ENDIKS*YFGR flap structure specific endonuclease 1 S25          
NP_001153045 Fip1l1 DHS*PTPSVFNSDEER FIP1 like 1 isoform 1 S479   0.40   -0.05  
NP_001153045 Fip1l1 ERDHS*PTPSVFNSDEER FIP1 like 1 isoform 1 S479   -0.54   0.02  
NP_001153045 Fip1l1 DHSPT*PSVFNSDEER FIP1 like 1 isoform 1 T481       0.01  
NP_001153045 Fip1l1 ERDHSPT*PSVFNSDEER FIP1 like 1 isoform 1 T481       0.28  
NP_001038993 Fkbp15 HNQDSQHCS*LSGDEEDELFK FK506 binding protein 15 S1157          
NP_001038993 Fkbp15 HNQDSQHCSLS*GDEEDELFK FK506 binding protein 15 S1159       -0.43  
NP_001038993 Fkbp15 RLS*LTPDPEKGEPPALDPESQGGEAQPPECK FK506 binding protein 15 S1091       -0.22  
NP_038930 Fkbp3 FLQDHGS*DSFLAEHK FK506 binding protein 3, 25kDa S34          
NP_038930 Fkbp3 FLQDHGSDS*FLAEHK FK506 binding protein 3, 25kDa S36          
NP_666130 Flcn AHS*PAEGASSESSSPGPK folliculin S62       0.81  
NP_034357 Flna RAPS*VANIGSHCDLSLK filamin, alpha S2144   1.12   1.37  
NP_034357 Flna S*PFSVGVSPSLDLSKIK filamin, alpha S959          
NP_001074654 Flnc LGS*FGSITR filamin C, gamma S2234   -0.40 0.23 0.41  
NP_034359 Flt3 DT*QLYVLR FMS-like tyrosine kinase 3 T164          
NP_001036787 Fmn1 RLSPVPS*PLS*PR formin 1 isoform 2 S524, S527          
NP_001071166 Fmnl1 S*PRTKALVLELLAAVCLVR formin-like 1 isoform 2 S264          
NP_001108137 Fnbp1l ES*PEGSYTDDANQEVR formin binding protein 1-like isoform 1 S501   -0.24      
NP_001108137 Fnbp1l TIS*DGTISAAK formin binding protein 1-like isoform 1 S295   -0.19 -0.39 -0.37 *
NP_061298 Fnbp4 RPILQLS*PPGPR formin binding protein 4 S65       0.03  
NP_061298 Fnbp4 ALEEGDGSVSGSS*PR formin binding protein 4 S486   -0.89 -0.15 0.06  
NP_796065 Fndc7 CHT*HQNHCLLGCIT*CGINYTVALK fibronectin type III domain containing 7 T587, T598          
NP_001156471 Fnip2 LTRT*VVIGK folliculin interacting protein 2 T500     8.03    
NP_032059 Fnta EYWRY*IGRSLQSKHCR farnesyltransferase, CAAX box, alpha Y358          
NP_032618 Foxc1 T*ENGT*CPSPPQPLSPAAALGSGSAATVPK forkhead box C1 T230, T234       0.09  
NP_032618 Foxc1 TENGT*CPSPPQPLS*PAAALGSGSAATVPK forkhead box C1 T234, S243       -0.17  
NP_032618 Foxc1 TENGTCPS*PPQPLS*PAAALGSGSAATVPK forkhead box C1 S237, S243   0.03 -0.12 -0.37  
NP_951031 Foxk1 EEAPAS*PLRPLYPQISPLK forkhead box K1 S199   -0.17      
NP_951031 Foxk1 EGS*PIPHDPDLGSK forkhead box K1 S431   -0.33 0.14 0.00  
NP_951031 Foxk1 SSGLQT*PECLS*R forkhead box K1 T422, S427       -0.14  
NP_001074401 Foxk2 EGS*PAPLEPEPGASQPK forkhead box K2 S389   -0.08      
XP_911424 Frem3 QHLHFS*PGVSVQR PREDICTED: similar to FRAS1-related extracellular matrix protein 3 precursor (NV domain-containing protein 2) S2066       6.31  
NP_038550 Frg1 MAEY*S*Y*VK FSHD region gene 1 Y4, S5, Y6          
NP_659188 Frs3 SHS*GFPVPLTR fibroblast growth factor receptor substrate 3 S384          
NP_082470 Fryl TRS*LSSLR furry homolog-like isoform 1 S1979       0.24  
XP_141020 Fsip2 QGSRVLAKVS*ST*LS*KVFSR PREDICTED: similar to fibrous sheath-interacting protein 2 S6457, T6459, S6461          
XP_141020 Fsip2 SDS*HLLT*S*LET*CTKK PREDICTED: similar to fibrous sheath-interacting protein 2 S129, T133, S134, T137   -5.02      
NP_080402 Fundc2 FEALDLAELT*KK FUN14 domain containing 2 T22          
NP_001073856 Fusip1 S*FDYNYR FUS interacting protein (serine-arginine rich) 1 isoform 2 S133   0.17      
NP_001073856 Fusip1 S*RS*FDYNYR FUS interacting protein (serine-arginine rich) 1 isoform 2 S131, S133       0.79  
NP_001106659 Fxr1 RGPNYTSGYGTNSELSNPS*ETESER fragile X mental retardation-related protein 1 isoform 1 S438   0.15      
NP_035944 Fxr2 AGYTT*DESSSSSLHTTR fragile X mental retardation-related protein 2 T413   0.58   -3.60  
NP_035944 Fxr2 TGGPAYGPSSDPSTAS*ETESEKR fragile X mental retardation-related protein 2 S455          
NP_387468 Fxyd4 ATPLIIPGSANT*C corticosteroid-induced protein T87          
NP_387468 Fxyd4 IIPGSANT*C corticosteroid-induced protein T87          
NP_038744 G3bp1 YQDEVFGGFVTEPQEES*EEEVEEPEER ras-GTPase-activating protein SH3-domain  binding protein S149   0.28 -0.12 0.27  
NP_038744 G3bp1 S*TSPAPADVAPAQEDLR ras-GTPase-activating protein SH3-domain  binding protein S229   0.18 -0.09 0.02  
NP_038744 G3bp1 ST*SPAPADVAPAQEDLR ras-GTPase-activating protein SH3-domain  binding protein T230   0.05 -0.06 0.06  
NP_038744 G3bp1 STS*PAPADVAPAQEDLR ras-GTPase-activating protein SH3-domain  binding protein S231   0.05 -0.06 0.11  
NP_001074263 G3bp2 S*ATPPPAEPASLPQEPPK Ras-GTPase-activating protein (GAP120) SH3-domain binding protein 2 isoform a S225   0.09      
NP_001074263 G3bp2 SAT*PPPAEPASLPQEPPK Ras-GTPase-activating protein (GAP120) SH3-domain binding protein 2 isoform a T227   0.29 0.00 0.04  
NP_001074264 G3bp2 S*ATPPPAEPASLPQEPPKPR Ras-GTPase-activating protein (GAP120) SH3-domain binding protein 2 isoform b S225     0.10 -0.08  
NP_001074264 G3bp2 SAT*PPPAEPASLPQEPPKPR Ras-GTPase-activating protein (GAP120) SH3-domain binding protein 2 isoform b T227   -0.36   -0.08  
NP_062341 G6pd2 AT*PEERPKLEEFFT*R glucose-6-phosphate dehydrogenase 2 T91, T103          
NP_032110 Gapdh IVSNASCT*T*N glyceraldehyde-3-phosphate dehydrogenase T151, T152          
NP_032110 Gapdh LVINGKPIT*IFQER glyceraldehyde-3-phosphate dehydrogenase T73          
NP_079985 Gapvd1 S*RSSDIVSSVR GTPase activating protein and VPS9 domains 1 S879       2.87  
NP_079985 Gapvd1 SRS*SDIVSSVR GTPase activating protein and VPS9 domains 1 S881   -0.49 -0.32 0.07  
NP_001106816 Gatad2a RPPS*PDVIVLS*DSEQPS*SPR p66 alpha isoform b S96, S103, S109          
NP_001106816 Gatad2a RPPS*PDVIVLS*DSEQPSS*PR p66 alpha isoform b S96, S103, S110       -0.27  
NP_001070879 Gba DFISRDLGPALANSS*HDVK glucosidase, beta, acid isoform 2 S291          
NP_849261 Gbf1 ADAPDAGAQS*DSELPSYHQNDVSLDR golgi-specific brefeldin A-resistance factor 1 S1298       -0.19  
NP_849261 Gbf1 GYTS*DSEVYTDHGRPGK golgi-specific brefeldin A-resistance factor 1 S1318   -0.28   0.41  
NP_849261 Gbf1 GYTSDS*EVYTDHGRPGK golgi-specific brefeldin A-resistance factor 1 S1320       -0.26  
NP_032155 Gclm VSAKLFIVGS*NSS*SS*T*R glutamate-cysteine ligase, modifier subunit S100, S103, S105, T106          
NP_034402 Gdf11 LKPLT*GEGTAGGGGGGRRHIR growth differentiation factor 11 T202          
NP_032138 Gdi2 MT*GSEFDFEEMKR guanosine diphosphate (GDP) dissociation inhibitor 2 T425          
NP_766146 Gemin5 APS*QPPS*PTEER gem (nuclear organelle) associated protein 5 S1410, S1414       0.39  
NP_001124492 Gfap AKEPT*KLADVY*QAELR glial fibrillary acidic protein isoform 1 T107, Y113          
NP_038556 Gfpt1 VDS*TTCLFPVEEK glutamine fructose-6-phosphate transaminase 1 S243   0.48 0.03 -0.16  
NP_038556 Gfpt1 VDST*TCLFPVEEK glutamine fructose-6-phosphate transaminase 1 T244     -0.01    
NP_034411 Ggh HFPT*ELLDS*LALENLTANFHKWS*LS*VK gamma-glutamyl hydrolase T178, S183, S197, S199          
NP_113596 Gigyf1 S*IEEGDGAFGR PERQ amino acid rich, with GYF domain 1 S137          
NP_666224 Gigyf2 WRPHS*PDGPR GRB10 interacting GYF protein 2 isoform a S237   -0.26   -0.04  
NP_001103682 Gigyf2 ALSSGGSITS*PPLS*PALPK GRB10 interacting GYF protein 2 isoform b S26, S30   -24.29   -1.47  
NP_001103682 Gigyf2 AGAEASEEVPQTSLSSARPGT*PSDHQPQEATQFER GRB10 interacting GYF protein 2 isoform b T377   0.50   -0.58  
NP_032402 Gimap1 FTMQDS*QALAAVK GTPase, IMAP family member 1 S128   -4.58      
NP_032402 Gimap1 LILVGRTGT*GK GTPase, IMAP family member 1 T37          
NP_777620 Gimap9 NLVVVDT*PGLFDT*K GTPase, IMAP family member 9 T64, T70          
NP_001028505 Gm239 RT*GS*KKPTKVS*FSGR hypothetical protein LOC237558 T599, S601, S608          
NP_001018041 Gm414 GDVGS*EGKRGS*DGLPGLRGDS*GPK otolin-1 S278, S284, S294          
XP_144253 Gm444 FIGLS*EDVVSFFARER PREDICTED: similar to Gm444 protein S830          
NP_001094942 Gm4931 RT*PVKVS*MMKMK hypothetical protein LOC238395 T235, S240          
NP_001028939 Gm4951 SPAVFT*PTDEET*IQERLSR hypothetical protein LOC240327 T346, T352          
NP_941035 Gm5124 ANS*SS*S*EEEEEEEERR hypothetical protein LOC331392 S431, S433, S434          
NP_001028954 Gm5592 VT*S*GPSDQVRKNK hypothetical protein LOC434172 T432, S433       >10  
NP_001025060 Gm608 NRVSSYSAEALIGKS*SSTSDQRMGIS*IQGSR hypothetical protein LOC207806 S1653, S1664          
NP_001028610 Gm906 S*VRFSDDS*GPDKAPSK hypothetical protein LOC380882 S141, S148          
NP_001074505 Gm9294 MT*RGPKKHLKR predicted gene 9294 T2          
NP_932769 Gmip SLDS*PTS*SPGAGAR Gem-interacting protein S436, S439          
NP_932769 Gmip SLDS*PTSS*PGAGAR Gem-interacting protein S436, S440       -0.47  
NP_001028472 Gmps TLNMTTS*PEEK guanine monophosphate synthetase S332   0.57      
NP_001028472 Gmps TLNMTT*SPEEK guanine monophosphate synthetase T331   0.52   0.01  
NP_032164 Gnai2 AVVYS*NTIQSIMAIVK guanine nucleotide binding protein (G protein), alpha inhibiting 2 S75   -5.92      
NP_032162 Gnal1 EEQTDTS*DGESVTHHIR guanine nucleotide binding protein, related sequence 1 S51       0.18  
NP_663527 Gnl2 EEKKT*S*AEDS*DAAPTKK guanine nucleotide binding protein-like 2 (nucleolar) T642, S643, S647          
NP_705775 Gnl3 ELS*PEQSTAGKPSDGSSALDR guanine nucleotide binding protein-like 3 (nucleolar) long isoform S505   0.02   0.42  
NP_038775 Golga5 KKS*EPDDELLFDFLNSSQK golgi autoantigen, golgin subfamily a, 5 S116   1.54   2.50  
NP_038775 Golga5 KKS*EPDDELLFDFLNSSQKEPTGR golgi autoantigen, golgin subfamily a, 5 S116       1.35  
NP_038775 Golga5 S*EPDDELLFDFLNSSQK golgi autoantigen, golgin subfamily a, 5 S116   2.07      
NP_084311 Golgb1 KVS*EIEDQLKK golgi autoantigen, golgin subfamily b, macrogolgin 1 S2655   5.71   6.13  
NP_001030294 Golm1 LQEEVPS*EEQMPQEK golgi membrane protein 1 S213   0.33      
NP_081628 Gorasp2 VPTTVEDRVS*DCTPAVEKPVSDADASEPS golgi reassembly stacking protein 2 S432   0.17      
NP_032176 Gpc4 ICPQDY*T*CCS*QEMEEKYSLQSKDDFK glypican 4 Y64, T65, S68       >10  
NP_776108 Gpkow KHS*PDRQDGPVPK G patch domain and KOW motifs S348   0.42      
NP_598517 Gpn1 GTLDEEDEEADS*DTDDIDHR GPN-loop GTPase 1 S338       0.03  
NP_473385 Gpr124 GDGEPEPT*GSR G protein-coupled receptor 124 T1151          
NP_035081 Gpr143 T*VT*S*VASLLKGR G protein-coupled receptor 143 T216, T218, S219          
NP_001004761 Gpr158 RGS*NQGPRGLGHSWRR G protein-coupled receptor 158 S239   -13.89      
NP_001028462 Gpr55 Y*PILASHLR G protein-coupled receptor 55 Y124       0.25  
NP_780729 Gpr81 AT*RFIMVVAS*VFITCY*LPSVLAR G protein-coupled receptor 81 T219, S227, Y233   2.05      
NP_852109 Gprc5a AQAPAS*PYNDYEGR G protein-coupled receptor, family C, group 5, member A S344   -0.75 -2.28 -2.34  
NP_663345 Gps1 EGS*QGELTPANSQSR G protein pathway suppressor 1 S454     0.89    
NP_080516 Gramd3 SVCGHLENTS*VGNS*PNPSSAENSFR GRAM domain containing 3 S221, S225       -0.41  
NP_080516 Gramd3 SVCGHLENT*SVGNS*PNPSSAENSFR GRAM domain containing 3 T220, S225       -0.41  
NP_062391 Grasp KVLT*LEK GRP1 (general receptor for phosphoinositides 1)-associated scaffold protein T102       >10  
NP_062391 Grasp LQQKEEAT*AAPDPAGRAPDSEAAR GRP1 (general receptor for phosphoinositides 1)-associated scaffold protein T16          
NP_034475 Grb10 T*TARFS*KK growth factor receptor bound protein 10 T135, S140          
NP_034476 Grb7 LSYLGS*PPLR growth factor receptor bound protein 7 S364   -0.49   0.40  
NP_034476 Grb7 TNHRLS*LPTTCSGSSLSAAIHR growth factor receptor bound protein 7 S414       -0.02  
NP_056579 Greb1 NEALES*DGEK Greb1 protein S1092          
NP_058582 Gria3 RSKIAVYEKMWSY*MKSAEPSVFT*K glutamate receptor, ionotropic, AMPA3 precursor Y699, T709          
NP_032192 Grid1 T*EELNRYRDTLR glutamate receptor, ionotropic, delta 1 T214          
NP_032193 Grid2 YMDYS*VGVLLR glutamate receptor, ionotropic, delta 2 S544          
NP_796353 Grit S*AKSEESLTSLHAVDGDSK Rho GTPase-activating protein S354       -0.01  
NP_796353 Grit SAKS*EESLTSLHAVDGDSK Rho GTPase-activating protein S357       0.02  
NP_796353 Grit VVYAFS*PK Rho GTPase-activating protein S543       -1.18  
NP_766327 Grlf1 KVS*AVSKPVLYR glucocorticoid receptor DNA binding factor 1 S1150          
NP_001026837 Gsk3a GEPNVS*YICSR glycogen synthase kinase 3 alpha S278   0.16 0.09 0.22  
NP_001026837 Gsk3a GEPNVSY*ICSR glycogen synthase kinase 3 alpha Y279   -0.17 -0.03 0.08  
NP_062801 Gsk3b TTS*FAESCKPVQQPSAFGSMK glycogen synthase kinase 3 beta S9   0.07      
NP_034488 Gstm1 MLLEYT*DSSYDEK glutathione S-transferase mu 1 T24          
NP_034488 Gstm1 RYT*MGDAPDFDR glutathione S-transferase mu 1 T34       -0.12  
NP_032209 Gstm2 YT*MGDAPDYDR glutathione S-transferase mu 2 T34          
NP_032210 Gstm6 FLPS*PVYLK glutathione S-transferase mu 6 S206     -7.59    
NP_598562 Gtf2f1 GT*S*RPGTPSAEAASTSSTLR general transcription factor IIF, polypeptide 1 T384, S385   0.21   -0.30  
NP_598562 Gtf2f1 GT*SRPGT*PSAEAASTSSTLR general transcription factor IIF, polypeptide 1 T384, T389   0.25      
NP_598562 Gtf2f1 GT*SRPGTPS*AEAASTSSTLR general transcription factor IIF, polypeptide 1 T384, S391       -0.44  
NP_598562 Gtf2f1 GTS*RPGT*PSAEAASTSSTLR general transcription factor IIF, polypeptide 1 S385, T389   0.38   -0.24  
NP_598562 Gtf2f1 GTS*RPGTPS*AEAASTSSTLR general transcription factor IIF, polypeptide 1 S385, S391   0.66      
NP_598562 Gtf2f1 ST*PSSGDVQVTEDAVR general transcription factor IIF, polypeptide 1 T437   -0.67      
NP_997122 Gtf3c1 VAAS*PRPGAEEQAEAQAPAQLAAPEDADAGGPR general transcription factor III C 1 S1890   0.38   -0.06  
NP_038846 Gtpbp1 SRS*PVDSPVPASMFAPEPSS*PGAAR GTP binding protein 1 S8, S25       -0.85  
NP_001007577 Gucy2f T*EKLLT*QMLPLS*VAES*LK guanylate cyclase 2f T853, T858, S864, S868          
NP_109603 Gys1 YPRPAS*VPPS*PSLSR glycogen synthase 1 (muscle) S641, S645       -0.06  
NP_032230 H2-M2 WVAVVVPS*GK histocompatibility 2, M region locus 2 S279          
NP_775576 Haus6 DRPAAVDLLPPMS*PLTFDPVSEEVYAK HAUS augmin-like complex, subunit 6 S405   -1.03      
NP_032254 Hdac1 IACEEEFS*DS*DEEGEGGRK histone deacetylase 1 S421, S423       0.17  
NP_032254 Hdac1 MLPHAPGVQMQAIPEDAIPEES*GDEDEEDPDKR histone deacetylase 1 S393   0.83   -0.44  
NP_032255 Hdac2 MLPHAPGVQMQAIPEDAVHEDS*GDEDGEDPDKR histone deacetylase 2 S394   0.46   -0.79  
NP_032255 Hdac2 IACDEEFS*DS*EDEGEGGRR histone deacetylase 2 S422, S424       -0.06  
NP_032257 Hdgf AGDVLEDS*PK hepatoma-derived growth factor S165   -0.15 -0.33 -0.13  
NP_032257 Hdgf AGDVLEDS*PKRPK hepatoma-derived growth factor S165   0.35   -0.14  
NP_032257 Hdgf GDVLEDS*PKRPK hepatoma-derived growth factor S165       0.15  
NP_032257 Hdgf GSAEGS*S*DEEGKLVIDEPAK hepatoma-derived growth factor S132, S133   0.31   -0.09  
NP_032257 Hdgf GSAEGS*S*DEEGKLVIDEPAKEK hepatoma-derived growth factor S132, S133       -0.36  
NP_032257 Hdgf GSAEGS*SDEEGKLVIDEPAK hepatoma-derived growth factor S132       0.64  
NP_032257 Hdgf GSAEGS*SDEEGKLVIDEPAKEK hepatoma-derived growth factor S132       -0.08  
NP_032257 Hdgf GSAEGSS*DEEGKLVIDEPAK hepatoma-derived growth factor S133   0.40   0.76  
NP_032257 Hdgf GSAEGSS*DEEGKLVIDEPAKEK hepatoma-derived growth factor S133       0.33  
NP_032257 Hdgf KGSAEGS*S*DEEGKLVIDEPAK hepatoma-derived growth factor S132, S133       -0.41  
NP_032257 Hdgf KGSAEGS*SDEEGKLVIDEPAK hepatoma-derived growth factor S132       -0.39  
NP_032257 Hdgf NS*TPSEPDSGQGPPAEEEEGEEEAAKEEAEAQGVR hepatoma-derived growth factor S199   0.10   -0.63  
NP_032257 Hdgf NST*PSEPDSGQGPPAEEEEGEEEAAKEEAEAQGVR hepatoma-derived growth factor T200   0.32   -0.67  
NP_032257 Hdgf NSTPS*EPDSGQGPPAEEEEGEEEAAKEEAEAQGVR hepatoma-derived growth factor S202   0.31   -0.67  
NP_032257 Hdgf NSTPSEPDS*GQGPPAEEEEGEEEAAKEEAEAQGVR hepatoma-derived growth factor S206       -0.25  
NP_032257 Hdgf RAGDVLEDS*PK hepatoma-derived growth factor S165   0.02 0.18 -0.07  
NP_032257 Hdgf RAGDVLEDS*PKRPK hepatoma-derived growth factor S165   0.44   -0.05  
NP_032259 Hdgfrp2 AQEDGQDS*EDGPR hepatoma-derived growth factor-related protein 2 S620   -0.01      
NP_032259 Hdgfrp2 GGS*S*GEELEDEEPVK hepatoma-derived growth factor-related protein 2 S366, S367       0.08  
NP_032259 Hdgfrp2 GGS*S*GEELEDEEPVKK hepatoma-derived growth factor-related protein 2 S366, S367       0.04  
NP_032259 Hdgfrp2 KRS*EGLSLER hepatoma-derived growth factor-related protein 2 S450       0.37  
NP_032259 Hdgfrp2 TRLAS*ES*ANDDNEDS hepatoma-derived growth factor-related protein 2 S659, S661       0.66  
NP_659037 Hectd1 TNATNNMNLS*R HECT domain containing 1 S1567   -1.47   -1.84  
NP_080268 Herc5 MLDLPKYS*SMRRMK hect domain and RLD 5 S980          
NP_620092 Hexim1 GQNGEDLSTGGAS*PSAEGEPMSESLVQPGHDSEATK hexamethylene bis-acetamide inducible 1 S103   0.19      
NP_620092 Hexim1 GQNGEDLSTGGASPS*AEGEPMSESLVQPGHDSEATK hexamethylene bis-acetamide inducible 1 S105   0.00      
NP_001152800 Hgs KS*PTPSAPVPLTEPAAQPGEGHTAPN HGF-regulated tyrosine kinase substrate isoform 1 S345   0.30      
NP_001156422 Hif3a LEAPTERHFS*LRMKSTLTS*R hypoxia inducible factor 3, alpha subunit isoform 1 S165, S174          
NP_001129537 Hipk2 AVCSTY*LQSR homeodomain interacting protein kinase 2 isoform 1 Y354       0.16  
NP_766334 Hirip3 AKVEGSTGANCQEES*EES*GEESPAK HIRA interacting protein 3 S231, S234       -0.43  
NP_766334 Hirip3 TLDS*EEEQPR HIRA interacting protein 3 S575       0.28  
NP_064418 Hist1h1b S*ET*APAETAAPAPVEKS*PAK histone cluster 1, H1b S2, T4, S18          
NP_663759 Hist1h1d S*ET*APAAPAAPAPVEKT*PVK histone cluster 1, H1d S2, T4, T18          
NP_291074 Hist2h4 RIS*GLIYEETR histone cluster 2, H4 S48   2.45 -0.25 0.12  
NP_034567 Hivep2 AGLVPFTESSVS*K human immunodeficiency virus type I enhancer binding protein 2 S256     0.00    
NP_001019891 Hmcn1 DENLKGVVY*TTRPLREAETYRMK hemicentin 1 Y5591          
NP_001020598 Hmga1 KLEKEEEEGIS*QESSEEEQ high mobility group AT-hook 1 S99       -0.03  
NP_001020598 Hmga1 EEEEGIS*QES*SEEEQ high mobility group AT-hook 1 S99, S102          
NP_001020598 Hmga1 EEEEGISQES*SEEEQ high mobility group AT-hook 1 S102          
NP_001020598 Hmga1 KLEKEEEEGISQES*SEEEQ high mobility group AT-hook 1 S102       -0.03  
NP_001020598 Hmga1 EEEEGISQES*S*EEEQ high mobility group AT-hook 1 S102, S103          
NP_001020598 Hmga1 KLEKEEEEGISQES*S*EEEQ high mobility group AT-hook 1 S102, S103       -0.13  
NP_001020598 Hmga1 KLEKEEEEGISQESS*EEEQ high mobility group AT-hook 1 S103       -0.03  
NP_034571 Hmga2 KPAQETEET*SSQES*AEED high mobility group AT-hook 2 T99, S104       -0.30  
NP_034571 Hmga2 KPAQETEET*SSQESAEED high mobility group AT-hook 2 T99       0.07  
NP_034571 Hmga2 KPAQETEETS*S*QESAEED high mobility group AT-hook 2 S100, S101       0.21  
NP_034571 Hmga2 KPAQETEETS*SQES*AEED high mobility group AT-hook 2 S100, S104       -0.41  
NP_034571 Hmga2 KPAQETEETSS*QES*AEED high mobility group AT-hook 2 S101, S104       -0.31  
NP_034571 Hmga2 KPAQETEETSS*QESAEED high mobility group AT-hook 2 S101       0.04  
NP_034571 Hmga2 KPAQETEETSSQES*AEED high mobility group AT-hook 2 S104       -0.43  
NP_034571 Hmga2 KQQQEPTCEPS*PK high mobility group AT-hook 2 S44       -0.32  
NP_032278 Hmgb2 MS*SYAFFVQTCR high mobility group box 2 S14          
NP_032279 Hmgb3 ST*NPGISIGDVAK high mobility group box 3 T114          
NP_032277 Hmgn1 QADVADQQTTELPAENGET*ENQSPAS*EEEKEAK high mobility group nucleosomal binding domain 1 T80, S87       0.06  
NP_032277 Hmgn1 QADVADQQTTELPAENGET*ENQSPAS*EEEKEAKS*D high mobility group nucleosomal binding domain 1 T80, S87, S95       -0.63  
NP_032277 Hmgn1 QADVADQQTTELPAENGET*ENQSPASEEEK high mobility group nucleosomal binding domain 1 T80   0.48      
NP_032277 Hmgn1 QADVADQQTTELPAENGETENQS*PAS*EEEK high mobility group nucleosomal binding domain 1 S84, S87       -0.58  
NP_032277 Hmgn1 QADVADQQTTELPAENGETENQS*PAS*EEEKEAK high mobility group nucleosomal binding domain 1 S84, S87       -0.58  
NP_032277 Hmgn1 QADVADQQTTELPAENGETENQS*PASEEEK high mobility group nucleosomal binding domain 1 S84   0.81      
NP_032277 Hmgn1 QADVADQQTTELPAENGETENQS*PASEEEKEAK high mobility group nucleosomal binding domain 1 S84   0.21 -0.24 -0.48  
NP_032277 Hmgn1 QADVADQQTTELPAENGETENQSPAS*EEEK high mobility group nucleosomal binding domain 1 S87   0.52      
NP_032277 Hmgn1 QADVADQQTTELPAENGETENQSPAS*EEEKEAK high mobility group nucleosomal binding domain 1 S87   1.06 -0.50 -0.54  
NP_032277 Hmgn1 QADVADQQTTELPAENGETENQSPAS*EEEKEAKSD high mobility group nucleosomal binding domain 1 S87       -0.14  
NP_032277 Hmgn1 QADVADQQTTELPAENGETENQSPASEEEKEAKS*D high mobility group nucleosomal binding domain 1 S95   0.71   -0.32  
NP_821136 Hmgxb4 SSAREHGT*AR HMG box domain containing 4 T352          
NP_032284 Hn1 S*NSSEASSGDFLDLK hematological and neurological expressed sequence 1 S85     -0.10    
NP_032284 Hn1 SNS*SEASSGDFLDLK hematological and neurological expressed sequence 1 S87   0.24      
NP_001034218 Hnrnpa1 NQGGYGGSSS*SSSYGSGR heterogeneous nuclear ribonucleoprotein A1 isoform b S363   0.61      
NP_001034218 Hnrnpa1 NQGGYGGSSSS*SSYGSGR heterogeneous nuclear ribonucleoprotein A1 isoform b S364   0.24      
NP_001034218 Hnrnpa1 NQGGYGGSSSSS*SYGSGR heterogeneous nuclear ribonucleoprotein A1 isoform b S365       -0.23  
NP_001034218 Hnrnpa1 NQGGYGGSSSSSS*YGSGR heterogeneous nuclear ribonucleoprotein A1 isoform b S366       -0.35  
NP_001034218 Hnrnpa1 S*ESPKEPEQLR heterogeneous nuclear ribonucleoprotein A1 isoform b S4   0.23 -0.05 1.03  
NP_001034218 Hnrnpa1 S*ESPKEPEQLRK heterogeneous nuclear ribonucleoprotein A1 isoform b S4       0.97  
NP_001034218 Hnrnpa1 SES*PKEPEQLR heterogeneous nuclear ribonucleoprotein A1 isoform b S6   0.13 -0.12 -0.01  
NP_001034218 Hnrnpa1 SES*PKEPEQLRK heterogeneous nuclear ribonucleoprotein A1 isoform b S6   0.13   -0.07  
NP_444493 Hnrnpa3 S*SGSPYGGGYGSGGGSGGYGSR heterogeneous nuclear ribonucleoprotein A3 isoform c S334   -0.17      
NP_444493 Hnrnpa3 SS*GSPYGGGYGSGGGSGGYGSR heterogeneous nuclear ribonucleoprotein A3 isoform c S335   -0.32 -0.12 0.06  
NP_444493 Hnrnpa3 SSGS*PYGGGYGSGGGSGGYGSR heterogeneous nuclear ribonucleoprotein A3 isoform c S337   -0.32 -0.12 -0.06  
NP_444493 Hnrnpa3 LFIGGLS*FETTDDSLR heterogeneous nuclear ribonucleoprotein A3 isoform c S21   -2.02      
NP_444493 Hnrnpa3 SSGSPY*GGGYGSGGGSGGYGSR heterogeneous nuclear ribonucleoprotein A3 isoform c Y339   0.04 -0.02 -0.13  
NP_444493 Hnrnpa3 SSGSPYGGGY*GSGGGSGGYGSR heterogeneous nuclear ribonucleoprotein A3 isoform c Y343   0.10      
NP_058580 Hnrnpc DDEKEPEEGEDDRDS*ANGEDDS heterogeneous nuclear ribonucleoprotein C S306   0.30   -0.08  
NP_058580 Hnrnpc MESEAGADDS*AEEGDLLDDDDNEDRGDDQLELK heterogeneous nuclear ribonucleoprotein C S268   2.66      
NP_058580 Hnrnpc NEKS*EEEQSSASVK heterogeneous nuclear ribonucleoprotein C S241   -0.57      
NP_058580 Hnrnpc QADLSFS*SPVEMK heterogeneous nuclear ribonucleoprotein C S231   0.08      
NP_058580 Hnrnpc QADLSFSS*PVEMK heterogeneous nuclear ribonucleoprotein C S232   0.14      
NP_058580 Hnrnpc SEEEQS*SASVKKDETNVK heterogeneous nuclear ribonucleoprotein C S246       -0.04  
NP_001070733 Hnrnpd IDASKNEEDEGHS*NSS*PR heterogeneous nuclear ribonucleoprotein D isoform a S80, S83       -0.13  
NP_001070733 Hnrnpd IDASKNEEDEGHS*NSSPR heterogeneous nuclear ribonucleoprotein D isoform a S80       -0.09  
NP_001070733 Hnrnpd IDASKNEEDEGHSNS*S*PR heterogeneous nuclear ribonucleoprotein D isoform a S82, S83       -0.16  
NP_001070733 Hnrnpd IDASKNEEDEGHSNS*SPR heterogeneous nuclear ribonucleoprotein D isoform a S82   -0.19   -0.07  
NP_001070733 Hnrnpd IDASKNEEDEGHSNSS*PR heterogeneous nuclear ribonucleoprotein D isoform a S83   0.26   -0.23  
NP_063921 Hnrnph2 HTGPNS*PDTANDGFVR heterogeneous nuclear ribonucleoprotein H2 S104   0.08   -0.02  
NP_063921 Hnrnph2 HT*GPNSPDTANDGFVR heterogeneous nuclear ribonucleoprotein H2 T100       0.18  
NP_063921 Hnrnph2 HTGPNSPDT*ANDGFVR heterogeneous nuclear ribonucleoprotein H2 T107   0.08   0.27  
NP_079555 Hnrnpk IIPTLEEGLQLPS*PTATSQLPLESDAVECLNYQHYK heterogeneous nuclear ribonucleoprotein K S116   -0.10      
NP_079555 Hnrnpk IILDLISES*PIK heterogeneous nuclear ribonucleoprotein K S216   0.12      
NP_079555 Hnrnpk DYDDMS*PR heterogeneous nuclear ribonucleoprotein K S284   -0.38   -0.23  
NP_079555 Hnrnpk RDYDDMS*PR heterogeneous nuclear ribonucleoprotein K S284   -0.38 -0.04 -0.29  
NP_079555 Hnrnpk IIPTLEEGLQLPSPT*ATSQLPLESDAVECLNYQHYK heterogeneous nuclear ribonucleoprotein K T118   -0.35      
NP_079555 Hnrnpk GSY*GDLGGPIITTQVTIPK heterogeneous nuclear ribonucleoprotein K Y380   2.53      
NP_058085 Hnrnpu AKS*PQPPVEEEDEHFDDTVVCLDTYNCDLHFK heterogeneous nuclear ribonucleoprotein U S247   0.94      
NP_001074665 Hnrnpul2 AVEEQGDDQDS*EKSKPAGSDGER heterogeneous nuclear ribonucleoprotein U-like 2 S183       -0.26  
NP_001074665 Hnrnpul2 AVEEQGDDQDS*EKSKPAGSDGERR heterogeneous nuclear ribonucleoprotein U-like 2 S183       -0.54  
NP_001074665 Hnrnpul2 S*GDETPGSEAPGDK heterogeneous nuclear ribonucleoprotein U-like 2 S159   0.03   -0.11  
NP_001074665 Hnrnpul2 S*KSPPPPEEEAKDEEEDQTLVNLDTYTSDLHFQISK heterogeneous nuclear ribonucleoprotein U-like 2 S224   1.06      
NP_001074665 Hnrnpul2 SKS*PPPPEEEAKDEEEDQTLVNLDTYTSDLHFQISK heterogeneous nuclear ribonucleoprotein U-like 2 S226   1.03      
NP_659051 Hnrpll LKTEEGEIVYS*AEESENR heterogeneous nuclear ribonucleoprotein L-like S37   0.28      
NP_789742 Hps6 LLSDLS*NFTGAARLR Hermansky-Pudlak syndrome 6 S14          
NP_059067 Hpx VY*LIQGTQVYVFLTK hemopexin Y317          
NP_032322 Hsf1 VKQEPPS*PPHS*PR heat shock factor 1 S303, S307       0.38  
NP_034610 Hsp90aa1 DKEVS*DDEAEEK heat shock protein 1, alpha S231   0.12      
NP_034610 Hsp90aa1 LGIHEDS*QNR heat shock protein 1, alpha S454          
NP_034610 Hsp90aa1 DKEVS*DDEAEEKEEK heat shock protein 1, alpha S231       -0.15  
NP_034610 Hsp90aa1 DKEVS*DDEAEEKEEKEEEK heat shock protein 1, alpha S231   0.62   -0.23  
NP_034610 Hsp90aa1 DKEVS*DDEAEEKEEKEEEKEK heat shock protein 1, alpha S231          
NP_034610 Hsp90aa1 DKEVS*DDEAEEKEEKEEEKEKEEK heat shock protein 1, alpha S231       0.67  
NP_034610 Hsp90aa1 ERDKEVS*DDEAEEKEEK heat shock protein 1, alpha S231       -0.21  
NP_034610 Hsp90aa1 ESDDKPEIEDVGS*DEEEEEK heat shock protein 1, alpha S263   -0.22   -0.01  
NP_034610 Hsp90aa1 ESDDKPEIEDVGS*DEEEEEKK heat shock protein 1, alpha S263   0.37 -0.17 -0.10  
NP_034610 Hsp90aa1 ESDDKPEIEDVGS*DEEEEEKKDGDK heat shock protein 1, alpha S263   0.60   -0.38  
NP_034610 Hsp90aa1 ESDDKPEIEDVGS*DEEEEEKKDGDKK heat shock protein 1, alpha S263       -0.41  
NP_034610 Hsp90aa1 GS*DEEEEEKK heat shock protein 1, alpha S263          
NP_032328 Hsp90ab1 EIS*DDEAEEEK heat shock protein 1, beta S226       0.06  
NP_032328 Hsp90ab1 EKEIS*DDEAEEEK heat shock protein 1, beta S226   0.11 0.17 0.02  
NP_032328 Hsp90ab1 IEDVGS*DEEDDSGK heat shock protein 1, beta S255   -0.08 -0.18 0.01  
NP_032328 Hsp90ab1 IEDVGS*DEEDDSGKDK heat shock protein 1, beta S255   0.64 0.00 -0.01  
NP_032328 Hsp90ab1 IEDVGS*DEEDDSGKDKK heat shock protein 1, beta S255   0.24   -0.13  
NP_032328 Hsp90ab1 IEDVGS*DEEDDSGKDKKK heat shock protein 1, beta S255       -0.10  
NP_032328 Hsp90ab1 KIEDVGS*DEEDDSGKDK heat shock protein 1, beta S255          
NP_032328 Hsp90ab1 IEDVGS*DEEDDS*GKDKK heat shock protein 1, beta S255, S261       0.05  
NP_032328 Hsp90ab1 IEDVGSDEEDDS*GKDK heat shock protein 1, beta S261       0.40  
NP_032328 Hsp90ab1 IEDVGSDEEDDS*GKDKK heat shock protein 1, beta S261       -0.05  
NP_032328 Hsp90ab1 RLS*ELLR heat shock protein 1, beta S452       2.28  
NP_032328 Hsp90ab1 TLTLVDTGIGMT*K heat shock protein 1, beta T94          
NP_032328 Hsp90ab1 EKEIS*DDEAEEEKGEKEEEDKEDEEKPK heat shock protein 1, beta S226       0.04  
NP_038586 Hspa1l NQVAMNPQNT*VFDAK heat shock 70kDa protein 1-like T68          
NP_001002012 Hspa2 S*TAGDTHLGGEDFDNR heat shock protein 2 S224          
NP_032326 Hspa4 AFS*DPFVEAEK heat shock protein 4 S76     0.42    
NP_034611 Hspa9 QAAS*SLQQASLK heat shock protein 9 S638          
NP_038587 Hsph1 IES*PKLER heat shock 105kD S810   0.05 -0.16 -0.18  
NP_067498 Huwe1 SPAFT*S*RLSGNRGVQYT*RLAVQR HECT, UBA and WWE domain containing 1 T3132, S3133, T3144          
NP_067498 Huwe1 ESNQPPEDSS*PPASSESSSTR HECT, UBA and WWE domain containing 1 S2919   0.10      
NP_034621 Iapp AT*PVRSGSNPQMDKRK islet amyloid polypeptide T24          
NP_001074751 Ibtk HHPELLDLFSRSGVY*VK inhibitor of Bruton's tyrosine kinase Y178          
NP_598549 Icmt VPT*GLPFIK isoprenylcysteine carboxyl methyltransferase T272          
NP_034009 Ift81 EEMPEQT*AKR carnitine deficiency-associated gene expressed in ventricle 1 T61     #####    
NP_034081 Igf2bp1 QGS*PVAAGAPAK insulin-like growth factor 2 mRNA binding protein 1 S181   -0.18      
NP_898850 Igf2bp2 ISYIPDEEVS*SPSPPHR insulin-like growth factor 2 mRNA binding protein 2 S161       0.31  
NP_898850 Igf2bp2 ISYIPDEEVSS*PSPPHR insulin-like growth factor 2 mRNA binding protein 2 S162       -0.14  
NP_898850 Igf2bp2 ISYIPDEEVSSPS*PPHR insulin-like growth factor 2 mRNA binding protein 2 S164       -0.13  
NP_034645 Igf2r LVSFHDDS*DEDLLHI insulin-like growth factor 2 receptor S2476          
NP_034645 Igf2r AEALSS*LHGDDQDSEDEVLTVPEVK insulin-like growth factor 2 receptor S2393   0.61      
NP_034645 Igf2r AEALSSLHGDDQDS*EDEVLTVPEVK insulin-like growth factor 2 receptor S2401   0.46      
NP_001153246 Ikbkb NNSCLS*KMKNAMASTAQQLKAK inhibitor of nuclear factor kappa B kinase beta subunit isoform 1 S466          
NP_035900 Ikzf2 RKS*STPQKFVGEK helios S278